... О UNИX . ... LibraryGnomeOrg_Evolution . Неизменяемая страница . ... Прикрепленные файлы . Другие действия: Показать разметку Вид для печати Сформатировать как Docbook Очистить кэш страницы ------------------------ Проверить правописание Похожие страницы Карта окрестностей ------------------------ Переименовать страницу Удалить страницу ------------------------ Подписать пользователя ------------------------ Очистить от спама Вернуть эту версию Страницы пакета Синхронизировать ...

Еще в разделе: (Показать все результаты (>67) - uneex.mithril.cs.msu.su/ )

• Index of /static/LibraryGnomeOrg_Evolution
• Index of /static/LibraryGnomeOrg_Evolution/figures

... E-MAIL ADDRESS: D.Khmelev@newton.cam.ac.uk . A new statistical method in the analysis of literary style for disputed authorship resolution is considered here. ... Consider a sequence of letter of text as a Markov chain. ... Suppose we take the logarithm of each probability, change a sign, and divide it by the length of control text; then each of the numbers obtained is called the relative empirical entropy . Relative empirical entropy is more convenient for computing than actual probabilities. ...

Еще в разделе: (Показать все результаты (>86) - old.philol.msu.ru/ )

• Konferences
• МГУ-ЛОКЛЛ:: Библиография основных работ А.А. Поликарпова за последние годы
• MSU-LGCLL:: Curriculum Vitae of Anatoliy Anatolyevich Polikarpov

... A.V. Eliseev . ... V.V. Adushkin, A.V. Vityazev, D.O. Glazachev, G.V. Pechernikova . Exogenous factors in the evolution of the Earth. ... Cosmic rays as a factor of biospheric evolution . ... A.V. Yakushev, N.A. Churilin, V.S. Soina, A.G. Kudinova, E.A. Vorobyova, N.S. Mergelov . ...

Еще в разделе: (Показать все результаты (>76) - comet.sai.msu.ru/ )

• IAC, Evolution of Galaxies, Conference

. [ Войти ] . Главная -> Фильмы -> Dragonball Evolution . Пользователи . Демо . Деньги . Фильмы . Форум . Dragonball Evolution . Драконий жемчуг: Эволюция . США 2009 . отметить . Приключение . Фантастика . Триллер . Фэнтэзи . Боевик .

Еще в разделе: (Показать все результаты (>78) - kinfo.ru/ )

• X-Men: Evolution - Фильмы - Kinfo.ru
• Epoch II: Evolution - Фильмы - Kinfo.ru
• Underworld: Evolution - Фильмы - Kinfo.ru

. Главное меню . Введение . Введение в задачи практикума STEV . Ознакомление . Знакомство с устройством задачи STEV . Расчет моделей . Расчет моделей звезд и эволюционных треков . Задания . Учебные задания . Теория . Краткая теория расчета эволюции звезд . Наблюдения . Сравнение теоретических расчетов с наблюдениями . Литература . Рекомендованная литература .

Еще в разделе: (Показать все результаты (>228) - observ.pereplet.ru/ )

• Справка по STEV
• Обсерватория

... WORKSHOP "STELLAR ATMOSPHERES" . THE CHEMICAL AND DYNAMIC EVOLUTION OF STARS AND GALAXIES" . ... Chernomorka , Odessa , Ukraine . ... Modeling and interpretation of the stellar spectra of the usual and peculiar stars. Elemental abundances in the stars of different types and populations of the Galaxy. Chemical evolution of the stars and galaxies. ... Andrievsky S.M. (OAO ONU, Odessa, Ukraine) . ... CHEMICAL and DYNAMIC EVOLUTION STARS and GALAXIES" . ... Odessa mailto:astro@paco.odessa.ua . ...

Еще в разделе: (Показать все результаты (>86) - sai.msu.ru/ )

... Студенческая Астрономическая обсерватория ГАИШ . ... Структура ГАИШ : Отдел внегалактической астрономии : . ... For those really interested in galaxies, extragalactic astronomy or the aspects of cosmology we study, we can always find an interesting problem to work on. ... To make your work in the Group most effective, it would be useful to study the following courses read by our group members as well as the members of other groups in our and other institures. ... Student information . ...

Еще в разделе: (Показать все результаты (>20) - www.sai.msu.ru/ )

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Re: Пятый чемпионат ГЗ по Pro Evolution Soccer! [ re: classic ] . ... Re: Пятый чемпионат ГЗ по Pro Evolution Soccer! [ re: MOHAX ] . ...

Еще в разделе: (Показать все результаты (>1571) - www.snto-msu.net/ )

• Evolution de l'Europe de l'an 1000 à 2005 - Public forum of MSU united
• Pro Evolution Soccer 2008 - Public forum of MSU united student networks
• Третий чемпионат ГЗ по Pro Evolution Soccer - Public forum of MSU united

... Abstract The analysis of works on the creation of modern nickel-base superalloys for casting the gas turbine single crystal blades was performed. The alloying features, the phase composition and physicochemical factors of high-temperature strength of nickel-base superalloys with rhenium content are considered. ... Moscow University Chemistry Bulletin . 2005, Vol. ... 3, P. 155 . Copyright (C) Chemistry Dept., ... Copyright (C) Chemisty Department of Moscow State University . ...

Еще в разделе: (Показать все результаты (>818) - chem.msu.ru/ )

• Phase and microstructure evolution in the process of the composite Bi-2212 -
• Moscow University Chemistry Bulletin Vol. 47, No. 5, P. 318 (2006)
• Moscow University Chemistry Bulletin Vol. 53, No. 4, P. 278 (2012)

Astronomy Picture of the Day . Evolution of the Moon . ... The Moon was likely created from debris expelled when a Mars-sized object violently impacted the Earth about 4.5 billion years ago. ... Rocks large and small continued to impact the surface, including a particularly large impact that created Aitken Basin about 4.3 billion years ago. A Heavy Bombardment period then continued for hundreds of millions of years, creating large basins all over the lunar surface. ... Moons and Jupiter . ...

Еще в разделе: (Показать все результаты (>9552) - www.astronet.ru/ )

• Illusion and Evolution in Galaxy Cluster Abell 2667
• Астронет > Illusion and Evolution in Galaxy Cluster Abell 2667
• Астронет > Международная конференция "Putting A Stars into Context: Evolution,

. Name . Last Modified . Size . Type . Parent Directory / . - . Directory . ChangeLog . 2016-Apr-03 18:31:17 . 5.7K . application/octet-stream . ChangeLog-2015 . 2015-Nov-09 07:11:44 . 93.6K . application/octet-stream . Manifest . 2016-Apr-03 18:31:17 . 2.6K . application/octet-stream . evolution-3.18.5.1.ebuild . 2016-Mar-07 11:06:56 . 4.1K . text/plain . evolution-3.18.5.2.ebuild . 2016-Apr-03 15:39:49 . 4.1K . text/plain . metadata.xml . 2016-Jan-25 02:06:09 . 0.9K . text/xml . lighttpd/1.4.35

Еще в разделе: (Показать все результаты (>16319) - mirror.msu.net/ )

• Index of /pub/gentoo-portage/gnome-extra/evolution-data-server/
• Index of /pub/gentoo-portage/sec-policy/selinux-evolution/
• Index of /pub/gentoo-portage/gnome-extra/evolution-ews/

... In the region of ferroelectric phase transition of Rb 2 ZnCl 4 crystals, the relaxation of incommensurate (soliton) structure (IS) transferred abruptly to a nonequilibrium state with uniaxial mechanical stress G has been studied. The evolution of IS was recorded by recording changes in the dielectric constant E along the Y axis. ... As a result the E, t-curves corresponding to different initial states intersect and further they follow again the time logarithmic law. ...

Еще в разделе: (Показать все результаты (>59) - scon155.phys.msu.su/ )

• Kinetics of domain structure in ferroelectric thin films

... Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>246) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika

... Для исследования была взята последовательность белка Malk_ecoli . ... Identities = 214/326 (65%), Positives = 257/326 (78%), Gaps = 13/326 (3%) Query 1 LRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGA 60 LR IAGLE ITSGDLFIGE+RMND P++RGVGMVFQSYALYPHL++ +NMSFGLKL+ A Sbjct 46 LRCIAGLEDITSGDLFIGEQRMNDVEPSKRGVGMVFQSYALYPHLNLYDNMSFGLKLSKA 105 Query 61 KKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLD 120 K I +RV+ AE+LQL+HLLDR+PKALSGGQRQRVAIGRTLV++P+VFLLDEPLSNLD ...

Еще в разделе: (Показать все результаты (>712) - kodomo.cmm.msu.ru/ )

• Practice1(evolution)
• evolution
• Gene Evolution Reconstruction

... MSU Codec Comparison aims to deliver high quality comparisons of video encoders to both industrial and scientific communities. ... The newest versions of MPEG-4 codecs comparison for their using by an ordinary user for home video compression. ... First Annual MPEG-4 AVC/ H.264 Video Codecs Comparison (January 2005) . ... Second Annual MPEG-4 AVC/H.264 Video Codecs Comparison(December 2005) . ... Third Annual MPEG-4 AVC/H.264 Video Codecs Comparison (December 2006) . ... Fifth H.264 codecs comparison...

Еще в разделе: (Показать все результаты (>222) - graphics.cs.msu.ru/ )

• MSU Video Codec Comparison | Лаборатория компьютерной графики и мультимедиа

New tests for high energy factorization in Drell-Yan lepton pair production Nikolay P. Zotov SINP MSU, Moscow, Russia in collaboration with S.P. Baranov, A.V. Lipatov N.P . Zotov QFTHEP 2013 , St. Petersburg , Russia , June 24, 2013 Content Introduction Theoretical framework - off-shell amplidudes - unintegrated ( TMD ) parton densities Numerical results Conclusions N.P . Zotov QFTHEP 2013 , St ...

Еще в разделе: (Показать все результаты (>183) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks2013/shleenkov.pdf
• http://qfthep.sinp.msu.ru/talks/QFTHEP2010Dolgopolov.pdf
• http://qfthep.sinp.msu.ru/proceedings2015/Quant_Bezuglov.pdf

... The Evolution of the Russian Tax System in the 19thcentury, . ... Ezhegodnik (Economic Hystory. ... 2002 , Moscow: ROSSPEN, 2003, p.345-383. ... The article deals with the history of the taxes of the Russian empire in the 19th century. ... Despite of the lag with the European model which consisted in the absence of income taxation, the Russian tax system had provided the budget with monetary resources, that were necessary for the financial stability of the Empire. ...

Еще в разделе: (Показать все результаты (>173) - hist.msu.ru/ )

• Project "The Labour Relations Evolution in Russian Industries"
• Международный форум "VI Congreso Internacional de Arqueologia e Informatica

... Students . ... Laboratory of Lithology and Facial Analysis . ... Laboratory of Marine Geology . ... The laboratory was organized as structural division of Faculty of Geology by the order of the Minister of Education of RSFSR in March, 1967. ... According to new structure of Faculty of Geology in 1976 the laboratory was included in structure of the Department of Dynamic Geology, and in 1983 was one of two laboratories including in structure of new Department of Lithology and Marine Geology. ...

Еще в разделе: (Показать все результаты (>70) - www.geol.msu.ru/ )

• Department of Lithology and Marine Geology - Generale Information
• Faculty of Geology >> Departments
• Faculty of Geology >> Geology at Moscow State University

Chair of General Physics and Wave Processes, Physics Faculty of MSU . ... Main Science and education Scientific Laboratories Laboratory of nonlinear polarization optics . ... The mechanisms of evolution of polarization during radiation propagation in nonlinear media with nonlocality of optical response. ... As a result, a new field of science has originated, the nonlinear polarization optics, providing new insights into the interplay of polarization effects in classic nonlinear optical processes. ...

Еще в разделе: (Показать все результаты (>135) - ofvp.phys.msu.ru/ )

• Публикация

Еще в разделе: (Показать все результаты (>125) - num-anal.srcc.msu.ru/ )