. PHP Manual . Prev . Next . (PHP 4 >= 4.0.5) pdf_setpolydash -- Sets complicated dash pattern . void pdf_setpolydash ( int pdf object, float * dasharray) . Set a more complicated dash pattern defined by an array. Prev . Home . Next . pdf_setmiterlimit . Up . pdf_setrgbcolor

Еще в разделе: (Показать все результаты (>32) - oit.cmc.msu.ru/ )

• VirtualHost Examples

... LanHEP version 3.2.0 (updated on Sep 30, 2015) source gzipped tar archive. ... LanHEP version 3.1.9 (updated on Nov 16, 2014) source gzipped tar archive. ... LanHEP version 3.1.8 (updated on July 21, 2013) source gzipped tar archive. ... LanHEP version 3.1.7 (updated on June 10, 2013) source gzipped tar archive. ... LanHEP version 2.0.7 (updated on May 24, 2002) source (gzipped tar archive) - the command line option '-mOmega' is implemented to produce the model files for micrOmega package. ...

Еще в разделе: (Показать все результаты (>1165) - theory.sinp.msu.ru/ )

• Importance sampling
• Tensor ghost.
• Gallery :: Perov, Taipey06 :: dsc07446

IT WAS LOVE By Russ Taft Oh doctor, I've got a hole in my heart The prescription you gave me ain't doing its part Take back your medicine, your complicated words I found something so simple you're gonna think its absurd Stronger than thunder Easy to pronounce It didn't cost me a penny (It was love , it was love ) ( Blinding light from above) Yeah (it was love , it was love ) I was looking everywhere then I finally ...

Еще в разделе: (Показать все результаты (>5720) - crydee.sai.msu.ru/ )

• http://crydee.sai.msu.ru/public/lyrics/cs-uwp/i/indigo.girls/least_complicated
• http://crydee.sai.msu.ru/public/lyrics/asv-collection/Lyrics/King_Crimson/kingcrim.84
• http://crydee.sai.msu.ru/public/lyrics/cs-uwp/k/king.crimson/three.perfect.pair

Еще в разделе: (Показать все результаты (>22) - npidb.belozersky.msu.ru/ )

• View 1b7f.B_213-281.1b7f.pdb2.pdb
• View 1l9z.H_281-363.1l9z.pdb1.pdb
• View 1nwq.A_281-334.1nwq.pdb1.pdb

start : 0, end : 30, IDs : [ 4g7z.pdb2.pdb :P:0: 266 : 345 , 4g7h.pdb2.pdb :P:0: 266 : 345 , 4g7z.pdb1.pdb :F:0: 266 : 345 , 4g7h.pdb1.pdb :F:0: 266 : 345 , 4g7o.pdb1.pdb :F:0: 266 : 345 , 3iyd.pdb1.pdb:F:0:458:535 , 4g7o.pdb2.pdb :P:0: 266 : 345 , 1l9z.pdb1.pdb:H:0: ...

Еще в разделе: (Показать все результаты (>2914) - monkey.belozersky.msu.ru/ )

• http://monkey.belozersky.msu.su/npidb/pdb/pdb_new/Block_3D/PF07716.10.blocks.json
• http://monkey.belozersky.msu.su/npidb/pdb/pdb_new/Block_3D/PF14374.1.fasta.hb
• http://monkey.belozersky.msu.su/npidb/pdb/pdb_new/Block_3D/PF14374.1.blocks.json

Environment Reconstruction Based on Soil Characteristics of the Lower Cycles of the Archaeological Site of Wallertheim (Rheinhessen, Germany) - A Soilscape and Soil System Dynamics Approach . Roger LANGOHR, Judit BESZE-DEAK, Soil Science Unit, Univ. ... The distribution gradient of various types of secondary carbonates permit a reconstruction of the paleotopography and paleoenvironment of the Last Interglacial alluvial plain. ... Back to the Abstracts list ...

Еще в разделе: (Показать все результаты (>696) - www.fadr.msu.ru/ )

... 1LDF 51 GVAMAIYLTAGVSGAHLNPAVTIALWLFACFDKRKVIPFIVSQVAGAFCA 100 A0W1Y5 101 AALVYGLYYNLFIDFEQTHHMVRGSVESLDLAGIFSTYPNPHINFVQAFA 150 || 1LDF 101 AALVYGLYYNLFFDFEQTHHIVRGSVESVDLAGTFSTYPNPHINFVQAFA 150 A0W1Y5 151 VEMVITAILMGVIMALGDDGNGIPRGPLAPLLIGLLIAVIGASMGPLTGF 200 || 1LDF 151 VEMVITAILMGLILALTDDGNGVPRGPLAPLLIGLLIAVIGASMGPLTGT 200 A0W1Y5 201 AMNPARDLGPKTFAFFAGWGEVAFTGAKDIPYFLVPLFGPIAGAALGAFG 250 || ...

Еще в разделе: (Показать все результаты (>514) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.ru/~svit/term4/pdb_uniprot.fasta
• http://kodomo.cmm.msu.ru/~famil/term4/files/prediction/alignment-1.needle
• http://kodomo.cmm.msu.ru/~lu.andreeva/needle1.needle

... Acousto-Optic Cells with Non-Uniform Length of Light and Sound Interaction . ... The paper examines operation of acousto-optic cells designed with cross section of acoustic columns different from the traditional rectangular form. ... It is evident that application of the   transducers possessing the complicated shape of the electrodes results in unequal lengths of light and sound interaction over cross section of an incident optical beam. ... Section : 9 ...

Еще в разделе: (Показать все результаты (>7) - acs366.phys.msu.su/ )

• Abstract (Invited)

Chapter€а5.€а Getting images into GIMP . ... Image types . ... Working with Images . ... There are three possible modes: RGB, grayscale, and indexed. ... Because every humanly distinguishable color can be represented as a combination of red, green, and blue, RGB images are full-color. ... Essentially the difference between a grayscale image and an RGB image is the number of тАЬ color channels тАЭ: a grayscale image has one; an RGB image has three. ... A color image in RGB mode with an Alpha channel. ...

Еще в разделе: (Показать все результаты (>121) - uneex.lorien.cs.msu.su/ )

• Appendix€аB.€а Reporting Bugs and Requesting Enhancements
• Index of /static/AltDocs_backup_before_install
• Index of /static/AltDocs_hd_structure

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Другие названия журнала: FEBS J , FEBS Journal 281 (S1) p.200 , FEBS Journal Special Issue: FEBS EMBO 2014 Conference показать полностью.. ... Akparov V.K. , Timofeev V.I. , Khaliullin I.G. , ?vedas V. , Chestukhina G.G. , Kuranova I.P. в журнале FEBS Journal , издательство Blackwell Publishing Inc. ...

Еще в разделе: (Показать все результаты (>233) - istina.msu.ru/ )

• Увенков Я.В. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• The Journal of diabetic complications - журнал | ИСТИНА - Интеллектуальная
• Journal of Diabetes and its Complications - журнал | ИСТИНА - Интеллектуальная

The Department of Talented Youth Affairs and Professional Orientation . ... Olympiads . ... The 48 th љMendeleev International Olympiad in Chemistry for School Pupils was scheduled to take place in Kiev fromљ May 11 to May 18, 2014 . ... The Mendeleev International Olympiad in Chemistry for School Pupils occupies a unique position on the list of prominent subject Olympiads. ... The Olympiad consists of 3 rounds ? ... 2016 - The Department of Talented Youth Affairs and Professional Orientation ...

Еще в разделе: (Показать все результаты (>7) - talant.msu.ru/ )

• News | The Department of Talented Youth Affairs and Professional Orientation |

Next: Mixing UUCP and RFC-822 Up: How does Mail Routing Previous: Mail Routing on the . ... In earlier times, all mail had to be addressed using bang paths. ... Therefore, only a number of major hosts use the complete UUCP world maps to build their paths file. Most sites only maintain routing information for sites in their neighborhood, and send any mail to sites they don't find in their databases to a smarter host with more complete routing information. ...

Еще в разделе: (Показать все результаты (>63) - itpm.msu.su/ )

• Name Lookups with DNS
• Assigning IP-Addresses
• Serial Line IP

Russian J. Theriol. 2 (1): 1 © RUSSIAN JOURNAL OF THERIOLOGY, 2003 2HAB=?A On July 13, 2003 we celebrate ninety years of the outstanding Russian theriologist Professor Igor Mikhailovich Gromov. His contribution to study of systematics and phylogeny of the largest and most taxonomically complicated mammal order, the Rodentia, is difficult to overestimate. ... His influence on forming of scientific ideology of people, who worked alongside with him, or were his students, was tremendous. ...

Еще в разделе: (Показать все результаты (>323) - zmmu.msu.ru/ )

• Morphofunctional interpretation of the quills stridulating in tenrecs
• Russian Journal of Theriology

THE LABORATORY OF CHEMISTRY AND PHYSICS OF SENSOR AND SEMICONDUCTOR MATERIALS . PhD, scientist Roman B. Vasiliev . ... Chemistry and physics of colloidal nanocrystals ( colloidal quantum dots ): growth of A2B6 colloidal nanocrystals; synthesis of nanocrystals with complicated morphology; synthesis of colloidal nanoheterostuctures; optical properties of colloidal systems: core-shell nanocrystals, branched nanocrystals, nanocrystals with spatial carriers separation. Semiconductor interfaces. ...

Еще в разделе: (Показать все результаты (>3) - www.lssm.inorg.chem.msu.ru/ )

. This Guide describes how to get started with MicroEMACS. For details on how to perform more complicated functions consult the MicroEMACS Reference Manual or read the manual page. Entering MicroEMACS commands . Creating a new file . Opening an existing file . Viewing a file . Entering text . Moving round the text . Deleting text . Moving, copying and deleting blocks of text . Saving and closing files . Searching for text . Replacing text .

Еще в разделе: (Показать все результаты (>35) - comet.sai.msu.ru/ )

• More on environment variables in csh/tcsh

... Arrays are handled somewhat awkwardly in CORBA. ... If the array element is a string or an object reference, then the mapping uses the same type as for structure members. ... Besides the Array_forany mapping the CORBA standard also describes a mapping for an array slice . ... Output parameters and results are handled via pointers to array slices. ... SS_slice* bar( const SS ss1, SS ss2, SS_slice*& ss3, long_arr arr ) { //... ss3 = SS_alloc(); SS_slice *res = SS_alloc(); return res; }; }; . ...

Еще в разделе: (Показать все результаты (>164) - rtm-cs.sinp.msu.ru/ )

• Compiler and Linker Wrappers

diff -Naur graphtft-30.orig /dfbrenderer/dfbrenderer.c graphtft-30 /dfbrenderer/dfbrenderer.c --- graphtft-30.orig /dfbrenderer/dfbrenderer.c 2012-03-12 03:27:38.000000000 + 0100 +++ graphtft-30 /dfbrenderer/dfbrenderer.c 2012-03-12 03:29:35.000000000 + 0100 @@ -257,7 +257,7 @@ { // make path relative to the themes directory - asprintf ( path , %s/ graphTFT / themes /%s/%s , + asprintf ( ...

Еще в разделе: (Показать все результаты (>3078) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/bcp/bcp171.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc68.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc613.txt.pdf

LEARNING AND OPTIMIZATION OF FEEDFORWARD NEURAL NETWORK BY MEANS OF MULTIAGENT GENETIC ALGORITHM Komartsova L.G. Kaluga Branch of Moscow Bauman State Technical University Russia, 248000, Bagenov street, 4, tel.: ... Though, synthesis of a neural network for concrete tasks decision is a complicated procedure and id defined by such criteria as decision accuracy, number of recognition mistakes, time of learning, time of recognition etc. ... These methods are based on the optimization GA usage. ...

Еще в разделе: (Показать все результаты (>45) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc15759/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc184981/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc60265/doc.pdf

ISSN 0264-6021 . ... 1994: 297(1,2,3), 298(1,2,3,REV), 299(1,2,3), 300(1,2,3), 301(1,2,3), 302(1,2,3), 303(1,2,3), 304(1,2,3), 297-304(INDEXES) . 1993: (REV) . 1992: 281(1,2,3), 282(1,2,3), 283(1,2,3), 284(1,2,3), 285(1,2,3), 286(1,2,3), 287(1,2,3), 288(1,2,3), 281-288(INDEXES) . 1991: (REV), 273(1,2,3), 274(1,2,3), 275(1,2,3), 276(1,2,3), 277(1,2,3), 278(1,2,3), 279(1,2), 280(1,2,3) . ...

Еще в разделе: (Показать все результаты (>3143) - www.sevin.ru/ )

... Since parts of the MPI library may themselves be implemented using more basic MPI functions (e.g. a portable implementation of the collective operations implemented using point to point communications), there is potential for profiling functions to be called from within an MPI function which was called from a profiling function. ... However, if the wrapper functions are not in the profiling library, then none of the profiled entry points will be undefined when the profiling library is called. ...

Еще в разделе: (Показать все результаты (>95) - www.parallel.ru/ )

• nfstest | PARALLEL.RU - Информационно-аналитический центр по параллельным