Parallel algorithms of the RADUGA code for solving the transport equation via multiprocessor systems with shared memory" . Nikolaeva O.V., Bass L.P., Kuznetsov V.S. The parallel algorithms used in the RADUGA code to solve the transport equation for neutral particles in 1D-, 2D-, and 3D-regions by the discrete ordinates method on multiprocessor systems with shared memory is considered. ... Keywords: transport equation, spatial decomposition method, parallelization, parallel algorithms . ...

Еще в разделе: (Показать все результаты (>144) - num-meth.srcc.msu.ru/ )

• "Effective buffer management replacement algorithm for parallel shared-nothing
• "TIM-parallelization in a shared memory model using OpenMP interface"

. To yank the the current sentence into the temporary buffer: y) . To yank the text from the present cursor position to the the beginning of the current paragraph into the temporary buffer: y{ . To place the contents of the temporary buffer after the current cursor position: p .

Еще в разделе: (Показать все результаты (>524) - comet.sai.msu.ru/ )

• Example of how mail is displayed
• Example of debugging a shell script
• Examples of editing previous command lines

Alignment DNA issues are still actual in modern genetics. Known algorithms (for example, heuristic algorithm used by BLAST software, Needleman­Wunsch algorithm) are provide solution, but possible are not completely optimal by speed, computational resources or don't provide fullness search (needed accuracy) for solution finding. ... In this paper a method that can ensure absolute accuracy, is presented. ... Known methods of alignments are discussed and demonstrated. ...

Еще в разделе: (Показать все результаты (>140) - mccmb.belozersky.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>8) - storage.bioinf.fbb.msu.ru/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>14) - tukachev.flogiston.ru/ )

• Statistics One, Assignment One
• Category: Новости

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>64) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

. Участники . Исследования . Телеконференция . English Version | Сотрудники Центра | Партнерство . Оформление сайта . Сохраним природу . Учительская . Обучение . Олимпиада "Ломоносов" . Международное сотрудничество . Сайт поддерживается: . Институтом экологического почвоведения МГУ . Фондом исследования аграрного развития . webmaster@mail .

Еще в разделе: (Показать все результаты (>16) - www.ecocoop.ru/ )

• The Ecological Cooperation project is the first large scale childrenтАЩs
• Children's ecological telecommunication project

... As an example of such graphic software environments it is possible to name software «Alice» (http://www.alice.org/), which created by «Stage3 Research Group» (Carnegie Mellon University) and allows designing the virtual 3-D worlds, interactive games, animated stories without special programmer abilities. ... In «Alice» it is possible to create various 3Dprojecs, with ready or imported, for example from «3D Studio», models, using animation, sound-effects and object's transformation. ...

Еще в разделе: (Показать все результаты (>124) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc151681/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc151660/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc151654/eng.pdf

We have prepared some summation programs for working with Reduce output. ... 1 in $COMPHEP/test/sum.red $ % loading the summation package in symb1.red $ % reading contributions of diagrams sum; % writing the answer (32*ee**4*(2* p1.p2 **4-4* p1.p2 **3* p1.p3 +3* p1.p2 **2* p1.p3 **2-2* p1.p2 **2* p1.p3 *me**2-p1.p2* p1.p3 **3 + 2* p1.p2 * p1.p3 **2*me**2 + p1.p3 **2*me**4)) /(propden(-p1-p2,me,0)**2*propden(p2-p3,me,0)**2)$ %2 in $COMPHEP/test/sum2pole.red $ % loading the ...

Еще в разделе: (Показать все результаты (>908) - theory.sinp.msu.ru/ )

• fc3:dokuwiki:example [THEP]
• Examples

... About hotel . ... Rooms and prices . ... The hotel ?69th Parallel? is glad to present its renewed website which now has an option of online booking! ... The hotel ?69th Parallel? offers comfortable single and twin rooms and deluxe rooms relevant to the European standards. Every room has free WiFi connection. ... SINGLE STANDARD ROOM . Single occupancy ? 1 800 rub./day . ... 200 rub./person . ... 2 200 rub./day . ... The prices are in rubles for room a day and include the VAT (18%) . ...

Еще в разделе: (Показать все результаты (>22) - 69parallel.ru/ )

Russian . ... Projects . ... FADR conducts activities in (the) two general fields: information support for agribusiness and farmers, and the development and implementation of the new educational programms. ... The main focus of the Foundation for Agrarian Development Research (FADR) is the information support to agricultural producers. ... In 2000, the Canadian Agency for International Development regarded the Russian Rural Information Network project the best agricultural project. ...

Еще в разделе: (Показать все результаты (>110) - www.fadr.msu.ru/ )

... Сайт МГУ . ... Дистанционные олимпиады Факультета иностранных языков и регионоведения Интервью заместителя декана по информационно-образовательным технологиям Назаренко Аллы Леонидовны. фото дня Фоторепортаж с "Дня первокурсника" . ... Центр дистанционного образования МГУ имени М.В.Ломоносова предлагает школьным учителям обучение по следующим программам повышения квалификации: . ... Добавлена информация о дистанционной программе MBA Экономического факультета МГУ . ... и непрерывного образования МГУ,...

Еще в разделе: (Показать все результаты (>3) - www.distance.msu.ru/ )

... School problem is extremely important. ... Our President has mentioned the territorial disparity, i.e. two-thirds of our schools are the rural schools and their graduates are at unequal terms with their equals from cities' schools to get following education. ... Create special conditions in education for disabled children, for orphans and children from unfortunate families, pupils from rural schools and gifted children. ... Ensure social equity for all children during school education and after it. ...

Еще в разделе: (Показать все результаты (>26) - www.rsr-online.ru/ )

• http://www.rsr-online.ru/doc/norm/111.doc

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>135) - bioinf.fbb.msu.ru/ )

• Alignment example
• SDPsite - Algorithm Format requirements
• User's guide

... Run source ./setup.csh 6. ... When you will start to work next time, run setups in following order : cd /data1/atlas/work source ../software/12.0.8/setup.csh cd testarea/12.0.8/ source $ATLAS_ROOT/../work/cmthome/setup.csh -tag=12.0.8 To exclude first two lines, just add to your .login these lines : # add Atlas env-s : source /data1/atlas/software/12.0.8/setup.csh After that next time just do : source $ATLAS_ROOT/../work/cmthome/setup.csh -tag=12.0.8 cd /data1/atlas/work/testarea/12.0.8/ . ...

Еще в разделе: (Показать все результаты (>7) - lhe.sinp.msu.ru/ )

A.N. Belozersky Institute . Bioinformatics Portal . ... Russian EMBnet Node . ... AliBee - Multiple alignment Release 2.0 . ... Grants information . ... Our Institute is a scientific department of Moscow State University. ... Address: Belozersky Institute,Moscow State University,Leninskie Gory 1,Bldg. ... Information about our activities and EMBnet resources around the World is available here . Information about our educational activities with kids, children and teenagers is available here . ...

Еще в разделе: (Показать все результаты (>120) - www.genebee.msu.ru/ )

• RNA secondary structure prediction
• Screening pattern or alignmemt against PROTEIN databank
• AliComp - GeneBee Alignments Comparison - Advanced

QUANTUM STOCHASTIC PROCESSES This course is for 4-5th year and graduate students. ... It is dedicated to systematic account of Quantum Stochastic Processes right in the form they are actually used in theoretical calculations of Quantum Open Systems. ... LECTURE 2. ... Open systems and quantum stochastic processes. Mathematical definition of an open system and quantum stochastic process. ... Markovian quantum stochastic processes. Formal definition of quantum markovian stochastic process. ...

Еще в разделе: (Показать все результаты (>69) - qilab.phys.msu.ru/ )

e-mail: viverhovin@yandex.ru) , , , corruption, the western enforcement system, corruption scandals, statistics of corruption in the western countries . ... Analysis and criticism of some apologetics examples of the western market society, not capable to minimize corruption at different levels of its organization is given. Necessary statistical and actual arguments in favor of the author's viewpoint are resulted. ...

Еще в разделе: (Показать все результаты (>17) - vestnik.socio.msu.ru/ )

... Corporate Social Policy as an Approach to Managing the Workforce: Some Examples from U. S. History, . ... Corporate social policy is one of the most significant subjects studied by business historians. To attract workers and maintain sound businesses some Russian entrepreneurs adopted paternalistic social welfare policies, described in several recently published works. ...

Еще в разделе: (Показать все результаты (>72) - hist.msu.ru/ )

• "Novaya i noveishaia istoria" Journal
• Economic History. Yearbook. 2001
• Shares at St.Petersburg Stock Exchange in 1900s

... Главная -> Фильмы -> Children On Their Birthdays . ... Фильмы . ... Children On Their Birthdays . ... США 2002 . ... Joe Pichler . ... Tom Arnold . ... Cynthia Baker . Tom Brainard . ... Alexander Piccolo . ... Joe Van Slyke . ...

Еще в разделе: (Показать все результаты (>320) - kinfo.ru/ )

• Children of the Grave - Фильмы - Kinfo.ru
• Children of Dune - Фильмы - Kinfo.ru
• While the Children Sleep - Фильмы - Kinfo.ru