... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>15) - tukachev.flogiston.ru/ )

• Category: Новости

... use of several physical disks to run each PC GAMESS/Firefly process so that each copy uses only its own HDD. ... The LAM/MPI version 7.1.X. Note that the PC GAMESS/Firefly is not compatible with older LAM/MPI versions e.g., 6.5.9. ... Please consult with the LAM/MPI documentation and manual pages before start experimenting with parallel PC GAMESS/Firefly runs. The LAM/MPI-linked PC GAMESS/Firefly binaries should present on all the computers you plan to run the PC GAMESS/Firefly in parallel . ...

Еще в разделе: (Показать все результаты (>72) - classic.chem.msu.su/ )

• PC GAMESS/Firefly DOCUMENTATION - running in parallel under Windows using
• PC GAMESS/Firefly DOCUMENTATION - running in parallel under Windows using WMPI
• PC GAMESS/Firefly DOCUMENTATION - running in parallel Linux/MPICH binaries

О лаборатории . ... Лаборатория теоретической биофизики . ... Posted by Peter Mamonov in Без рубрики . ... ab initio basis sets cp2k education Firefly FRAP GAMESS gromacs MDAnalysis membrane mmb nano OPLS pymol python scipy sparse matrix toolset topology познавательно учебные материалы . OPLS-AA patch for different types of molecules . ... All-atom automatic OPLS-AA topology generator . ... OPLS-AA? in All-atom automatic OPLS-AA topology? ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>41) - erg.biophys.msu.ru/ )

• toolset ERG Research Group: Лаборатория теоретической биофизики
• python ERG Research Group: Лаборатория теоретической биофизики

... Wiki . ... wiki: InterTrac . ... An InterTrac link can be seen as a scoped TracLinks . It is used for referring to a Trac resource (Wiki page, changeset, ticket, ...) located in another Trac environment. ... If the targeted Trac is running a version below тАЛ 0.10 ( тАЛ r3526 to be precise), then it doesn't know how to dispatch an InterTrac link, and it's up to the local Trac to prepare the correct link. ... trac:wiki:InterTrac тАЛ trac:wiki:InterTrac . ... trac:ticket:234 тАЛ trac:ticket:234 . ...

Еще в разделе: (Показать все результаты (>1869) - kodomo.cmm.msu.ru/ )

• example.snake in snakes тАУ Python Battle
• TracUnicode т?? Tanchiki
• TracNavigation тАУ Tanchiki

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>16) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>133) - bioinf.fbb.msu.ru/ )

• Alignment example
• User's guide

... NetCDF User's Guide for C . ... more standard error behavior, by uniformly communicating an error status back to the calling program in the return value of each function. ... We are hoping that the benefits of the new interface will be an incentive to use it in new netCDF applications. ... The new interface handles errors differently than netCDF-2. ... Where the netCDF-2 interface used NC_LONG to identify an external data type corresponding to 32-bit integers, the new interface uses NC_INT instead. ...

Еще в разделе: (Показать все результаты (>209) - angel.cs.msu.su/ )

• ExtensionFileFilter
• : Package ucar.multiarray
• Appendix B File Format Specification

Myotis . Uropatagium venation pattern in bats as diagnostic character (by the example of genus Myotis ) . ... By the example of genus Myotis it was shown that venation pattern on uropatagium of bats in some cases can be used as diagnostic character. Venation features on uropatagium allow easy to separate Daubentonв?Ts bat, eastern water bat, big-footed bat, and pond bat from Brandtв?Ts bat, Siberian bat, whiskered bat, and Ikonnikovв?Ts bat. ... Bats]. ... Bats of the Russian Far East]. ...

Еще в разделе: (Показать все результаты (>572) - zmmu.msu.ru/ )

. Name . Last modified . Size . Description . Parent Directory . - . alpha/ . 2007-02-10 22:19 . - . alpha_and_beta/ . 2007-02-10 22:19 . - . beta/ . 2007-02-10 22:19 . - . Apache/2.4.12 (Debian) Server at kodomo.fbb.msu.ru Port 80

Еще в разделе: (Показать все результаты (>10753) - kodomo.fbb.msu.ru/ )

• allpy: a9d4a06ed103 allpy/markups.py
• allpy: b4b6cfe02285 allpy/markups.py
• allpy: cf15f7653423 allpy/markups.py

... Instructions are in README.TXT file inside the tarball. ... tar -xvf nhunt_x86.tar Query and database files should contain sequences in FASTA format ( wikipedia description ). ... Default name of the output file is 'nhunt.out'. ... Any parameter consists of key and value and is called as '-key value', where 'key' is one character and 'value' is any number of characters. -i Query file . ... No default value. -d Database file . ... No default value. -o Output file . ... Default value: 'nhunt.out' . ...

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• ConClus
• Align tool for DNA-protein complexes
• Nhunt

Fortran-DVM . ... Language description . ... 2.2 Syntax of FDVM directives . ... 4.2 Distribution of dynamic arrays . ... 6 Remote data specification . ... 6.2 SHADOW type references . ... 6.2.2 Synchronous specification of independent references of SHADOW type for single loop . ... 6.2.5 Asynchronous specification of independent references of SHADOW type . ... 6.3.3 Asynchronous specification of REMOTE type references . ... 6.4.2 Asynchronous specification of REDUCTION type references . ...

Еще в разделе: (Показать все результаты (>108) - sp.cs.msu.ru/ )

• C-DVM language description
• HPF DVM. Language specification
• Lib-DVM. Interface description. Part 7 (19)

... Corporate Social Policy as an Approach to Managing the Workforce: Some Examples from U. S. History, . ... Corporate social policy is one of the most significant subjects studied by business historians. To attract workers and maintain sound businesses some Russian entrepreneurs adopted paternalistic social welfare policies, described in several recently published works. ...

Еще в разделе: (Показать все результаты (>72) - hist.msu.ru/ )

... Next: COM-port initialization file format Up: Scanning Probe Microscopy Image Previous: Software Installation Contents Index . File is written in text format and consists from one section. ... A record has following format: <voltage>=<temperature>; . ... Example of temperature initialization file listed below. [temperature] -3.00=27.5; -2.67=28.0; -2.33=29.0; -2.00=31.5; -1.67=33.5; -1.33=36.0; -1.00=37.0; -0.67=39.0; -0.33=42.0; 0.00=42.5; 0.33=45.0; 0.67=47.5; 1.00=49.0; 1.33=50.0; 3.00=60.0; . ...

Еще в разделе: (Показать все результаты (>72) - www.spm.genebee.msu.ru/ )

... 14.06.2015 . ... Credit Copyright: Robert Gendler Explanation: Why do many galaxies appear as spirals ? ... One result is that M101, also called the Pinwheel Galaxy, has several extremely bright star-forming regions (called HII regions ) spread across its spiral arms. ... June 2015 . ... Publications with keywords: M 101 - spiral galaxy - spiral arms . Publications with words: M 101 - spiral galaxy - spiral arms . ... Sculptor Galaxy NGC 134 . NGC 3310: A Starburst Spiral Galaxy . ...

Еще в разделе: (Показать все результаты (>3692) - www.astronet.ru/ )

• Other Worlds and HD 38529
• Journal "Peremennye Zvezdy"

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>51) - monkey.belozersky.msu.ru/ )

• Example of supporting positions
• SCOP famyli:
• HF clusters: algorithm

. [Назад к основному тексту]

Еще в разделе: (Показать все результаты (>1261) - chem.msu.ru/ )

• Entrance Examinations - Preliminary Round
• Entrance Examinations - Main Round
• Dmitriy Mendeleev Online

... YUI 2 Examples . ... Contains an un-archived and ready for use copy of YUI 2.8.0 - see http://developer.yahoo.com/yui . ... You do not need to install anything in the browser to use this extension. ... Select "Install". ... See http://foswiki.org/Support/ManuallyInstallingExtensions for more help. ... Copyright : . ... update to v2.8.0 and add v3.0.0 -- Foswiki:Main.AndrewJones . ... http://foswiki.org/Extensions/YahooUserInterfaceContrib . This topic: System > YahooUserInterfaceContrib . ...

Еще в разделе: (Показать все результаты (>2225) - wiki.cs.msu.ru/ )

• IncludeTopicsAndWebPages < System < Foswiki
• FootNotePlugin < System < Foswiki
• (backlinks in System Web) VarFORMFIELD < System < Foswiki

... Ryabov G.G., Serov V.A. The development of discrete models for representations of nonconvex parts of $R^3$ space and the solution of routing problems with a metric that approximates the Euclidean metric on these models continue to remain fundamental in the fields of robotics, geoinformatics, computer vision, and designing of VLSI. The paper deals with a lattice-cellular model. ... PostScript (in Russian) (8.56MB) . PDF (in Russian) (1.21MB) . PostScript. zip (in Russian) (1.33MB) . ...

Еще в разделе: (Показать все результаты (>134) - num-meth.srcc.msu.ru/ )

• Mathematical modeling of multicomponent gas flows with energy intensive

Online Services | ... Nuclear Wallet Cards" . USA National Nuclear Data Center - NNDC . ... Nuclei Selection: . All nuclei Only even Only odd . ... Decay Type: . decay . ... CDFE Head: Vladimir V. Varlamov . ...

Еще в разделе: (Показать все результаты (>17) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Nucleus Ground State Parameters
• CDFE provides the major photonuclear databases. Online Services.
• CDFE => Online Services => NSR Search Engine

LangueDOC . ... Languages . ... Archi . ... The phonetic system of Archi is very rich, and the writing systems that are familiar to Archi speakers (Russian cyrillic and Avar cyrillic) are not sufficient for recording all sounds of the language. ... Kibrik et al. 1977] ? the notation used in this dictionary is given in the comparative table below under the label "1977"; [Kibrik, Kodzasov 1990]), but they were too difficult for the Archi speakers to learn and therefore remained inaccessible to them. ...

Еще в разделе: (Показать все результаты (>194) - www.philol.msu.ru/ )