Keep the size of the tarfile to a minimum by excluding files that can be recreated from files contained in the tarfile. Examples are: .o (object) files that can be recreated by compiling the program source code.dvi files produced by processing TeX and LaTeX source files.ps (postscript) files generated by drawing and publishing packages. After you have created a tarfile, you can then reduce its size by using the compress command. ... This will create a file called project.tar.Z . ...

Еще в разделе: (Показать все результаты (>52) - comet.sai.msu.ru/ )

• Character Entity Set(s)

... It was found that various organic compounds and inorganic salts added in small concentrations to aqueous solutions increase the quantum yields of photochemical chain ion- radical substitution reactions of a halogen by sulpho group in halogenated naphthylamine (4- chloro-1-naphthylamine) and hydroxynaphthalenes (1-bromo-2-hydroxynaphthalene and 4- chloro-2-hydroxynaphthalene). ...

Еще в разделе: (Показать все результаты (>290) - chem.msu.ru/ )

• Time-of-flight mass spectroscopy detection of new elemental and mixed small
• Moscow University Chemistry Bulletin Vol. 56, No. 3, P. 147 (2015)
• Moscow University Chemistry Bulletin Vol. 46, No. 4, P. 236 (2005)

The purpose of this mini HOWTO is to describe how to run Linux on a system with a small amount of memory. Assuming buying more memory is out of the question there are many things you can do to tighten up memory usage in Linux. Many Linux distributions out of the box are quite bloated from a memory perspective. ... By removing many of these services you can free up several megabytes of real memory. ... Many Linux distributions run many daemons most of us will never use. ...

Еще в разделе: (Показать все результаты (>286) - rtm-cs.sinp.msu.ru/ )

... Parent Directory - 76.jpg 31-Mar-2002 13:00 5.9K 704.jpg 31-Mar-2002 12:41 4.8K 704_1.jpg 31-Mar-2002 12:40 4.8K 704_2.jpg 31-Mar-2002 13:04 5.6K 704_3.jpg 31-Mar-2002 13:05 5.3K 758.jpg 03-Apr-2002 21:01 5.1K 758_2.jpg 03-Apr-2002 21:00 4.8K 758_3.jpg 03-Apr-2002 21:08 5.1K 758_4.jpg 31-Mar-2002 13:30 6.8K 758_5.jpg 03-Apr-2002 21:09 4.4K 758_6.jpg 31-Mar-2002 13:32 6.1K 758_7.jpg ...

Еще в разделе: (Показать все результаты (>39) - sp.cs.msu.ru/ )

• Index of /images/neerc2001/small
• Index of /images/olymp2001/small
• Index of /images/zhogolev/small

... Faculty of Physics . M.V.Lomonosov Moscow State University . 7 (495) 939-16-82 info@physics.msu.ru . ... Contacts . ... Education . ... Dr. Michael Tribelsky (Faculty of Physics, Lomonosov Moscow State Univ.) in cooperation with his colleagues from the Institut Fresnel (France) and the Univ. of Cantabria (Spain) discovered a possibility of using dielectric spheres with a high refractive index as multifunctional elements of optical devices. ... 7 495 939-16-82, . ... Faculty of Physics, 2016 . ...

Еще в разделе: (Показать все результаты (>65) - phys.msu.ru/ )

... SmpB 1 - 2008-12-11 - Main.AndreyGolovin . ... During trans- translation, stalled bacterial ribosomes are rescued by small protein B ( SmpB ) and by transfer-messenger RNA (tmRNA). ... We present evidences that SmpB binds the large and small ribosomal subunits in vivo and in vitro . ... SmpB contacts the large subunit transiently and early during the trans -translational process. The affinity of SmpB for the two ribosomal subunits is modulated by tmRNA in the course of trans -translation. ...

Еще в разделе: (Показать все результаты (>30059) - dualopt1.cmm.msu.ru/ )

• SmpB - Projects - TWiki
• SmpB - Projects - TWiki - (printable)
• %TOPICTITLE% (1 vs. 2) - TWiki

sp|Q81842|SHDAG_HDVP1 Small delta antigen ; MSQTVARLT-SKEREEILEQWVEERKNRRKLEKDLRRANKKIKKLEDENPWLGNVVGLL- RRKKDEDGAPPAKRPRQETMEVDSGPGRKPKARGFTDQERRDHRRRKALENKKKQLAGGG KHLSQEEEEELRRLARDDDERERRTAGPRPGGVNPMDGPPRGAPGGGFVPSLQGVPESPF SRTGEGIDIRGTQQFP sp|Q91DH8|SHDAG_HDVV2 Small delta ...

Еще в разделе: (Показать все результаты (>1029) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~a_anisenko/term2/text/delta.fasta
• http://kodomo.fbb.msu.ru/~alex2308/align/delta_aligned.fasta
• http://kodomo.cmm.msu.ru/~maravilla/term2/delta.fasta

... Main Practical Applications Seen At Present Reactor Monitoring · In case of accident and no access into reactor , neutrino detector can follow state of nuclear reactions · Neutrino energy sp ectrum can determine comp osition of fissile materials and so indicate illegal use for b omb materials Geological Studies Search for mineral, fuel dep osits DIFFICULTIES I Neutral Current Detector sees all neutrino typ es I I ... Or consider detectors not resp onding to e/ background, like COUPP...

Еще в разделе: (Показать все результаты (>140) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/210809/Teryaev_lom09.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/250809/Vysotsky.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/210809/Kataev.pdf

... Fault tolerance of small-world regular and stochastic interconnection networks" . Demichev A.P., Ilyin V.A., Kryukov A.P., and Polyakov S.P. The fault tolerance of the most important properties of stochastic and regular (deterministic) small-world interconnection networks are studied. ... Demichev A.P. тАУ Skobeltsyn Institute of Nuclear Physics, Lomonosov Moscow State University; Leninskie Gory, Moscow, 119991, Russia; Ph.D., Senior Scientist, e-mail: demichev@theory.sinp.msu.ru . ...

Еще в разделе: (Показать все результаты (>73) - num-meth.srcc.msu.ru/ )

• "A small-mode approximation in the stellar dynamo problem"

... 161; --> ¡ --> cent sign ? ... 163; --> £ --> general currency sign ? ... yen sign ? ... 179; --> 3; ³ --> 3; acute accent ? ... 191; -- iquest; -- capital A, grave accent А #192; -- Agrave; -- capital A, acute accent Б #193; -- Aacute; -- capital A, circumflex accent В #194; -- Acirc; -- capital A, tilde Г #195; -- Atilde; -- capital A, dieresis or umlaut mark Д #196; -- Auml; -- capital A, ring Е #197; -- Aring; -- ...

Еще в разделе: (Показать все результаты (>11) - sbmg.geol.msu.ru/ )

... О UNИX . ... Неизменяемая страница . ... Другие действия: Показать разметку Вид для печати Сформатировать как Docbook Очистить кэш страницы ------------------------ Проверить правописание Похожие страницы Карта окрестностей ------------------------ Переименовать страницу Удалить страницу ------------------------ Подписать пользователя ------------------------ Очистить от спама Вернуть эту версию Страницы пакета Синхронизировать страницы ------------------------ ...

Еще в разделе: (Показать все результаты (>72) - uneex.mithril.cs.msu.su/ )

• Index of /static/AltDocs_unix_base_admin/images
• PspoMaterials/AltDocs_install_sb - UNИX
• PspoMaterials/AltDocs_whatis_sb - UNИX

. Название публикации . Оpposite changes of rat hindlimb cutaneous and skeletal muscle small arteries contraction after 2-week tail suspension . Авторы . V.U. Kalenchuk, O.S. Tarasova, A.S. Borovik, O.L. Vinogradova . Дата . 31.12.2009 23:00:00 . Название журнала . J. Gravitational Physiology. Купить нет на складе . 2009 ФФМ МГУ, 2009

Еще в разделе: (Показать все результаты (>6) - fbm.msu.ru/ )

... Small proteins . ... Glucocorticoid receptor-like (DNA-binding domain) . ... C-terminal, Zn-finger domain of MutM-like DNA repair proteins . ... Ribosomal protein L24e . ... Ribosomal protein S14 . ... Retrovirus zinc finger-like domains . ... Ribosomal protein L36 . ... Zn-binding ribosomal proteins . Ribosomal protein L32p . ... Ribosomal protein L33p . ... Ribosomal protein L37ae . ... Ribosomal protein L37e . ... Ribosomal protein L44e . ... Zn2/Cys6 DNA-binding domain . ...

Еще в разделе: (Показать все результаты (>209) - monkey.belozersky.msu.ru/ )

Microsymposium 40, abstract 81, 2004 (letter format) THE MORPHOMETRIC ANALISYS OF THE FEATURES OF MARTIAN CRATERS (10 ­ 20 km). ... In the present work the morphometric parameters for 180 small martian craters (with diameters from 10 up to 20 km) [2] have been determined: depth of a crater- , height of a rim ­ h, with the help of profiles constructed on the basis of supervision of space vehicle MGS [3].The comparison with similar morphometric parameters of small lunar craters [5] also is fulfilled. ...

Еще в разделе: (Показать все результаты (>108) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Bus/Publications/m44_14_busarev_etal.pdf
• http://selena.sai.msu.ru/Bus/Publications/ms34/MS012.pdf
• http://selena.sai.msu.ru/Bus/Publications/UFN2007(Bus_etal)(engl).PDF

University Satellites and . Space Science Education . General information Date and Location Objectives of the meeting Sponsoring Organizations International Advisory Committee Local Organizing Committee Deadlines Addresses Hotels & Accommodation Venue Visas Social Programme . First circular . Second circular . ... Abstract Submission List of submitted abstracts . ... The list of abstracts submited . Skobeltsyn Institute of Nuclear Physics, Moscow State University, 2005-2006 . ...

Еще в разделе: (Показать все результаты (>6730) - cosmos.msu.ru/ )

• Space Scientific and Education project of Lomonosov Moscow State University
• UNIVERSAT-2006 presentations

Jester», «Narr» «» , ( ) . small talk» . l'art pour l'art: ») . ... 2005. ... 108­109] . ... 297­318. .. : http://psyberlink. flogiston.ru/internet/bits/vandijk2.htm .. ... 1.Spaъmacher a) der andere unterhДlt, belust igt (im Theater, in der Literatur; an einem FЭrstenho f); b) scherzh. jmd., der sich kostЭmiert hat und ausgelassen mit vielen zusammen Fasching feiert [Abby Lingvo]. .: 1. , , , 2. , 3. . ... Weiъ der Kuckuck! ... 1998: 431]. .. , « » [: 109]. , « , ». «» [ 1973: 336]. , , , . ...

Еще в разделе: (Показать все результаты (>188) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~languedoc/assets/texts/xin-abc-full.pdf

... 6. 2 http :// lizard.phys.msu.su § лЁ (лElizavetЁ) : (1) ( Roman ): , , , , , ; (2) ( Italic ): , , , , , (3) ( SMALL C APS): , , , , , ; § л Ё (лElizavet NarrowЁ) : (1) ( Roman ): , , , , , ; (2) ( Italic ): , , , , , (3) ( SMALL CAPS ): , , , , , ; § лЁ (лLatinЁ) -- лЁ -- : (1) ( Roman ): , , , , , ; (2) ( Italic ): , , , , , ; (3) ( SMALL CAPS ): , , , , , ; (4) ( Bold ): , , , , , ; (5) ( Bold OT1, T1, T2A T2D. , : § "" , , http://lizard.phys.msu.su 5 , - . T2A T2D, , , . ...

Еще в разделе: (Показать все результаты (>14) - lizard.phys.msu.su/ )

... ,0x041b,0x041c,0x041d,0x041e, 0x041f,0x042f,0x0420,0x0421,0x0422,0x0423,0x0416,0x0412, Chernov [Page 1] RFC 1489 Registration of a Cyrillic Character Set July 1993 0x042c,0x042b,0x0417,0x0428,0x042d,0x0429,0x0427,0x042a }; -------------------------------------------- ... 82 83 84 85 86 87 88 89 8A 8B 8C 8D 8E 8F 90 91 92 93 94 95 96 97 98 99 9A 9B 9C 9D 9E 9F A0 A1 A2 A3 A4 A5 description FORMS LIGHT HORIZONTAL FORMS LIGHT VERTICAL ...

Еще в разделе: (Показать все результаты (>10796) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1489.txt
• http://mirror.msu.net/pub/gentoo-portage/media-video/frameworks/frameworks-0.3.7.ebuild
• http://mirror.msu.net/pub/gentoo-portage/net-misc/dropbear/dropbear-2014.66.ebuild

Micaceous picrites of the Sikhote-Alin ridg e . ... Regarding the issue of diamond potential, the Sikhote-Alin ridge comprises rare and specific igneous formations of high interest, such as micaceous picrites, which were discovered in the alluvial sediments of the Kedrovka river and as part of dikes and volcanic pipes near the settlement of Ariadnoe (Primorsky Krai). ... Representative assay results of micaceous picrites . ... Chemical composition of minerals of micaceous picrites . ...

Еще в разделе: (Показать все результаты (>431) - geo.web.ru/ )

• http://geo.web.ru/conf/alkaline/2009/Donskoy2.htm
• http://geo.web.ru/conf/alkaline/2009/Bagdasarov.htm
• http://geo.web.ru/conf/alkaline/2009/Tsymbal.htm

PHP Manual . ... This module uses the functions of the bzip2 library by Julian Seward to transparently read and write bzip2 (.bz2) compressed files. ... This module requires bzip2/libbzip2 version >= 1.0.x. This example opens a temporary file and writes a test string to it, then prints out the contents of the file. ... bzclose -- Close a bzip2 file pointer . ... bzerrno -- Returns a bzip2 error number . bzerror -- Returns the bzip2 error number and error string in an array . ... bzclose ...

Еще в разделе: (Показать все результаты (>124) - oit.cmc.msu.ru/ )

• Zlib Compression Functions
• bzdecompress
• chunk_split