... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . Институт проблем экологии и эволюции им. А.Н. Северцова РАН . Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: contains a scaled-down head . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>4910) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: contains a lesser head
• Экологический Форум - Фундаментальная Экология: tariffs will Beijing, contain
• Экологический Форум - Фундаментальная Экология: i just completed a whole

... Group Classification of Quasilinear Evolution Equations . ... We have proved, in particular, that the above class contains no nonlinear equations whose invariance algebra has dimension more than five. The principal result of group classification is the following: there are two, five, thirty--four, thirty--five and five inequivalent equations admitting one-, two-, three-, four- and five dimensional invariance algebras. ...

Еще в разделе: (Показать все результаты (>93) - acs366.phys.msu.su/ )

. [ Войти ] . Главная -> Фильмы -> Lego Star Wars: The Complete.. Пользователи . Демо . Деньги . Фильмы . Форум . Lego Star Wars: The Complete Saga . Великобритания 2007 . отметить . Комедия . Фантастика . Игра . Фэнтэзи . Боевик .

Еще в разделе: (Показать все результаты (>368) - kinfo.ru/ )

• Complete Savages - Фильмы - Kinfo.ru
• The Completely Mental Misadv.. - Фильмы - Kinfo.ru
• Civilization III: Complete - Фильмы - Kinfo.ru

... Feature of exciplexes with complete and partial electron transfer formed are analyzed. ... For exciplexes with complete charge transfer (the degree of charge transfer z>0.8 and the energy gap between CT- and LE-states in vacuum (driving force of electron transfer) (H220 - H110) < -0.3 eV), the main contribution to the exciplex energy gives the energy of electron transfer. ... Exciplex energy is substantially lower than that of LE-state even when (H220 - H110) > 0. ...

Еще в разделе: (Показать все результаты (>451) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 48, No. 3, P. 178 (2007)

... Python . ... О UNИX . ... HelpOnFormatting . Неизменяемая страница . ... Colorize text . Colorize code (Syntax Highlighting) . ... Mixing ''italic'' and '''bold''' . ... Nesting curly braces . ... Markup . ... Result . ... Markup: {{{{ This is a preformatted text block. {{{ with curly braces inside }}} }}}} . Result: This is a preformatted text block. {{{ with curly braces inside }}} . Markup: {{{#!highlight python from colors import palette palette.colorize('python') }}} . ...

Еще в разделе: (Показать все результаты (>142) - uneex.mithril.cs.msu.su/ )

• HelpOnInstalling/ApacheOnWin32withDomainAuthentication - UNИX

... About Conference . ... Bookstall . All books . Books by MCE participants . ... Password: . ... Approximate price in Conference bookstall 200 roubles. You need to submit Conference application first to order books to Conference bookstall. If you have already registered just enter your username and password. ... 2004 Designed by Lyceum of Informational Technologies ?1533 . ...

Еще в разделе: (Показать все результаты (>94) - www.mce.biophys.msu.ru/ )

... ON LANGUAGE . ... TOWARD THE LANGUAGE OF HAPPINESS . ...

Еще в разделе: (Показать все результаты (>122) - www.psy.msu.ru/ )

... Class . ... Nested classes inherited from class javax.swing.JApplet . ... private int . ... private java.lang.String[] . ... private static int . ... Fields inherited from class javax.swing.JApplet . ... Fields inherited from class java.applet.Applet . Fields inherited from class java.awt.Panel . Fields inherited from class java.awt.Container . Fields inherited from class java.awt.Component . ... Field Detail private static final int VERTICAL . ... private java.lang.String[] classes . ...

Еще в разделе: (Показать все результаты (>73) - angel.cs.msu.su/ )

• : Interface AttributeSet
• : Interface DimensionSet

... Numeration assumed . ... All contacts alignment . ... For this study 20 PDB-entries containing coordinates of ETS domains were used. These entries represent 10 proteins from two species: Homo sapiens and Mus musculus . ... X-ray . ... Yes . ... Homo sapiens . ... ETS-1 . ... The sequence alignment of all studied ETS domains . ... The alignment obtained reveals the conservative trinucleotide core GGA , which is recognized by ETS domain and is usually called EBS (ETS Binding Site). ...

Еще в разделе: (Показать все результаты (>602) - monkey.belozersky.msu.ru/ )

• Homeodomain numeration assumed
• SCOP classification
• ETS hydrogen bonds

Each Apache configuration directive is described using a common format that looks like this: . ... This indicates the format of the directive as it would appear in a configuration file. This syntax is extremely directive-specific, and is described in detail in the directive's definition. ... If the directive has a default value ( i.e. , if you omit it from your configuration entirely, the Apache Web server will behave as though you set it to a particular value), it is described here. ...

Еще в разделе: (Показать все результаты (>89) - neptun.sai.msu.ru/ )

• How Directory, Location and Files sections work
• Definitions of terms used to describe Apache modules
• Apache modules

Calculation of optimal coefficients for quadrature formulas by the complete enumeration method" . O.V. Belen'kaya, Ya.M. Zhileikin, and A.B. Kukarkin . Optimal coefficients of number-theoretic quadrature formulas are calculated for the two-dimensional case by the complete enumeration method. Optimal coefficients obtained by several different methods are compared. PostScript (in Russian) (87.1KB) . PDF (in Russian) (114KB) . PostScript. zip (in Russian) (30.7KB) . ...

Еще в разделе: (Показать все результаты (>56) - num-meth.srcc.msu.ru/ )

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ...

Еще в разделе: (Показать все результаты (>1321) - istina.msu.ru/ )

• Color Research and Application - журнал | ИСТИНА - Интеллектуальная Система
• Romashov A.A. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

Next: Administrivia and Stupid Mail Up: Installing sendmail Previous: Testing the sendmail.cf file . ... To complete the installation, it may be necessary to create the appropriate dbm tables to get the desired final results. ... If you are UUCP-only, you do not need to create any of the tables mentioned in the README.linux file. ... If you have uucpxtable entries to force UUCP delivery to certain UUCP neighbors who send their mail with Internet style domainized headers, that also needs to be tested. ...

Еще в разделе: (Показать все результаты (>368) - itpm.msu.su/ )

• The Linux Kernel (Copyright Notice)
• Taylor Configuration Files
• Basic HTML data types

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>121) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• Notes on searching by similarity

... MSU Chamber Orchestra . The Alia . This page contains information about the musicians who have played in our orchestra (see "members" for the current season team). Unfortunately, we have no pictures of all the people who played in the orchestra, and the available photos differ significantly in their quality. ... violini II) . ... viole) . Elena . ... violini I and II) . ... Natalia . ... violini I and II, viole) . ... celli) . ... Julia . ... violini I, viole) . ...

Еще в разделе: (Показать все результаты (>4) - music.genebee.msu.ru/ )

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... testing Test Complete . ... тул Test Complete для автотестирования, кто нить работал с ним? . ... Re: testing Test Complete [ re: nafania ] . ...

Еще в разделе: (Показать все результаты (>3370) - www.fds-net.ru/ )

• Новинки (аниме, осты, фильмы, дорамы...) - Public forum of MSU united student
• Программисты шутят - Public forum of MSU united student networks
• Продаю принтер Epson Stylus Color 685 - Public forum of MSU united student

... Наши ветераны . ... 11 Дек 2015 . ... размещено в: Наши ветераны | ... 11 Ноя 2015 . ... Декабрь 2015 . Ноябрь 2015 . Октябрь 2015 . ... 2016 С Днем Победы! ... win 7 ultimate product key Windows 8 key windows 7 key win 7 key windows 7 pro product key win 7 pro product key windows 7 activation key windows 7 ultimate product key windows 7 ultimate serial key windows 7 key online win 7 ultimate key win 7 serial keys Win 7 ultimate ...

Еще в разделе: (Показать все результаты (>177) - elana.sinp.msu.ru/ )

• editor | С Днем Победы!
• . These stores offer complete and original associated with designer Gucci

... Sections . ... Division of Exhibition . ... Results of 2012 . Results of 2013 . ... Invertebrate Zoology . Section staff . History of the Section . ... Collections . Invertebrate collections . ... Schemes of the museum halls . ... Exhibition of Invertebrates . ... Exhibition of Insects Exhibition of Invertebrates Exhibition of Fish Exhibition of Amphibians Exhibition of Reptiles Exhibition of Oceanic Hydrothermal The Scientific Terrarium The Circle of Young Naturalists . ...

Еще в разделе: (Показать все результаты (>979) - zmmu.msu.ru/ )

• Global fossil bat records - abstract

Home People Activities Research Publications . ... Containers for image storage in memory, reading and writing of image files, Pipeline filtering library, D.Yurin "On the Images Pipe Line Filtering, PDF , color spaces, fast convolutions, image registration algorithms, edge curvature estimation via differential invariants (under development) , Bresenham algorithms, some numerical algorithms etc. ... Download help on project (CHM) , generated via doxygen (see How to document program's code ) . ...

Еще в разделе: (Показать все результаты (>9) - imaging.cs.msu.ru/ )

. Портал | Содержание | О нас | Авторам | Новости | Первая десятка | Дискуссионный клуб | Научный форум | Отправить открытку . Первая десятка "Русского переплета" Темы дня: . | Обращение к Дмитрию Олеговичу Рогозину по теме "космические угрозы": как сделать систему предупреждения? .

Еще в разделе: (Показать все результаты (>9) - www.pereplet.ru/ )