. PHP Manual . Prev . Next . (3.0.12 - 3.0.18 only, PHP 4 >= 4.0.0) pdf_set_border_color -- Sets color of border around links and annotations . void pdf_set_border_color ( int pdf object, float red, float green, float blue) . Set the border color for all kinds of annotations. Prev . Home . Next . pdf_setrgbcolor_stroke . Up . pdf_set_border_dash

Еще в разделе: (Показать все результаты (>362) - oit.cmc.msu.ru/ )

• ImageAlphaBlending
• Calendar functions
• Ncurses terminal screen control functions

Supernova 1987A in LMC . One day in 1987, an astronomer by the name of Ian Shelton was making observations of the Tarantula Nebula in Large Magellanic cloud at Las Campanas Observatory, and he noticed something strange on his image. ... SN 1987A got as bright as 2.7, the only other recent SN even to come close was 1885A in M31 which got up to mag 6. ... Mag 4.5 . ... IAUC 4318 2/25/87 Type II? ... IAUC 7354 2/1/00 New structure in the inner ring . ... IAUC 7360 2/7/00 HST observation of new spot . ...

Еще в разделе: (Показать все результаты (>185) - www.rochesterastronomy.org/ )

• Supernova 1999cl in M88
• Supernova 2004dj in NGC 2403
• Supernova images - Best of

... Dynamic Chaos and Fractals in Speech Rhythm . ... But it's yet rather surprisingly that this especially physical approach has appeared even more productive for explanation of many effects in such far from an engineering area as stuttering. In this paper we show the large-scale Voice/Unvoice temporal structure of normal and destroyed acoustic speech signal possesses the dynamical regimes set. ...

Еще в разделе: (Показать все результаты (>166) - acs366.phys.msu.su/ )

Cameras · ­ · · · · · · · · ! MATLAB · MATLAB · Let's design a camera Idea 1: put a piece of film in front of an object Do we get a reasonable image? ... Slide by Steve Seitz Shrinking the aperture Adding a lens A lens focuses light onto the film · Thin lens model: ­ Rays passing through the center are not deviated (pinhole projection model still holds) Slide by Steve Seitz Adding a lens focal point f A lens focuses light onto the film · Thin ...

Еще в разделе: (Показать все результаты (>13) - imaging.cs.msu.ru/ )

... Главная -> Фильмы -> When Strangers Appear . ... Фильмы . ... When Strangers Appear . ... Австралия - США - Новая Зеландия 2001 . ... Когда перепуганный, истекающий кровью Мэтт входит в затерянное кафе, которым владеет Бет, там закручивается серия загадочных событий. ... Бет решает спасти Мэтта, но его последующее исчезновение и дальнейшее общение с гостями только еще больше запутывают ситуацию, и Бет все глубже и глубже погружается в пучину их опасных игр. ...

Еще в разделе: (Показать все результаты (>412) - kinfo.ru/ )

• Color Of Night - Фильмы - Kinfo.ru
• Red Is the Color of - Фильмы - Kinfo.ru
• Primary Colors - Фильмы - Kinfo.ru

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>135) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help

... Shapley H. - Studies of the Magnitudes in Star Clusters IV. On the Color of Stars in the Galactic Clouds Surrounding Messier II . ... Название: Studies of the Magnitudes in Star Clusters IV. ... Автор: Shapley H. Язык: . ...

Еще в разделе: (Показать все результаты (>10854) - lib.mexmat.ru/ )

• Szempli W., Stupnicka S. - Chaos, Bifurcations and Fractals around Us: A Brief
• Jauncey G.E.M. - The Energy Reappearing as Characteristic X-Rays when X-Rays
• Lucas R., Plataniotis K.N. - Color Image Processing. Methods and Applications

... Run program . User's guide . Launching program . Input data format . ... Selecting the number of correlated pairs . ... In order to run thr program one needs Java 5.0 environment. ... At the end of computations one will be asked to review the selected number of correlated pairs. ... Note: One may redefine the number of correlated pairs by selecting the 'Edit' -> 'redefine correlated pairs number' menu item. Correlated pairs of positions are presented as a colored matrix, the heatmap. ...

Еще в разделе: (Показать все результаты (>6) - bioinf.fbb.msu.ru/ )

... Small islands and islets in the Kandalaksha Bay of the Russian White Sea are now rising. ... We tried to find plant species that are polymorphic enough to show the differences between the mainland and island populations and the populations from the different islands. ... Species of Carex ( C. salina and C. aquatilis groups), Euphrasia, Achillea, Rhodiola, Atriplex and Parnassia were chosen for preliminary morphological analysis (~ 2200 plants were measured). ...

Еще в разделе: (Показать все результаты (>374) - herba.msu.ru/ )

• Floristic changes on the Kem
• Behaviour of white water-lily flowers in different photoperiods
• What's new?

... 2, Moscow 123182, Russia Sergey V. Razin Institute of Gene Biology, RAS, Vavilova st. 34/5, Moscow 119334, Russia sergey.v.razin@usa.net In Drosophila, interphase chromosomes are organized in topologically associated domains (TADs) within which chromatin-chromatin interactions are frequent, while interactions across domain borders are rare [1]. ... Here we used Hi-C method [5] to map TADs in four drosophila cell lines of different origin. ... Cell 48:471­84. ...

Еще в разделе: (Показать все результаты (>230) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/115.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/56.pdf

... About lab . ... Detection and correction of unnatural purple colors in images of refractive objects taken by digital still camera . ... color calibration , color correction , color management , digital still camera , light dispersion , monochromatic colors , perceptually uniform color spaces , RAW-processing . ... We discovered significant error in color in images produced by a digital still camera used to capture scenes with a special setup of illumination and an object. ...

Еще в разделе: (Показать все результаты (>201) - graphics.cs.msu.ru/ )

• Digital Microscope | Graphics and Media Lab
• Digital Microscope | Лаборатория компьютерной графики и мультимедиа
• Towards Automatic Stereo-video Quality Assessment and Detection of Color and

DESCRIPTION OF THE 1d SOLAR EVENT MAP . ... In the case of 1d Map this is 1 day interval around the moment of the solar wind stream start from the Sun. ... This date coincides with central day of the map marked by solid vertical line (in the present example - 8 June, 2000). ... The following phenomena are presented on the map: coronal holes, filaments, solar flares and the distribution of the solar magnetic field on the source surface (2.5 solar radii). ... The filaments are indicated by blue spots. ...

Еще в разделе: (Показать все результаты (>24) - dbserv.sinp.msu.ru/ )

• 3d Map Description

SVETKA, a program for analysis of different alignments . Back to the help page . ... Such a feature can look like " Leucine in the position 362 of the alignment of the entire family " and can, in many cases, be a "decision rule" to distinguish sequences from two sides of a tree branch. ... Comparing the alignment with an input tree (the tree may be entered by the user or reconstructed with the WPGMA algorithm), the program detects supporting positions of the alignment for every branch the tree. ...

Еще в разделе: (Показать все результаты (>31) - monkey.belozersky.msu.ru/ )

• About authors ot this complex
• SDP home page

обзор! astro-ph/0207223 . ... Author: Sultana N. Nahar . Comments: 15 pgs., 5 color figs., ... Comments: 46 pages including 16 figures, uses eas.cls, to appear in the proceedings of the Aussois 2001 summer school "Stades Ultimes de l'Evolution Stellaire", EAS Pub. ... Comments: 26 pages, 5 figures, submitted to ApJ . ... Commets: 5 pages, 4 figures, to appear in: Pis'ma v Astronomicheskii Zhurnal, 2003, v.29, No.2, p111-115 and will be translated as: Astronomy Letters, v.29, No.2, p.91-95 . ...

Еще в разделе: (Показать все результаты (>428) - astro.uni-altai.ru/ )

• Обзоры препринтов astro-ph

babl: babl (pixel format translation library) babl: babl: babl is a dynamic, any to any, pixel format translation library. babl: babl: It allows converting between different methods of storing pixels known babl: as pixel formats that have with different bitdepths and other data babl: representations, color models and component permutations. babl: babl: A vocabulary to formulate new pixel formats from existing primitives is babl: provided as well as the framework to add new color models and data types. babl:

Еще в разделе: (Показать все результаты (>16169) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/skel.ebuild
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc6233.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc6233.txt.pdf

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... When detection of the change-points in alpha band power was performed as in the previous subsection, more than one change-point per second was obtained in average. ... The hypothesis of the hierarchy of EEG segmental descriptions (Kaplan 1998) (see subsection 7.3.2) is a theoretical reason for introducing the adjustment of the change-point detection probability. ...

Еще в разделе: (Показать все результаты (>55) - brain.bio.msu.ru/ )

• Unsolved problems and new prospects
• Conclusion
• Analysis of change-point synchronization in multi-channel EEG

... Description . Catalog . ... In the Catalog, we publish equatorial (ЮБ 2000 , ЮД 2000 ) and galactic (l,b) coordinates of cluster centers derived as the position of overdensity in 2MASS catalog (Koposov et al. ... Distances, color-excesses and ages are the mean-square values calculated using all available evaluations from different color-magnitude diagrams. ... There are individual pages for every cluster where all available plots and parameters are published. ... 2002). ...

Еще в разделе: (Показать все результаты (>184) - ocl.sai.msu.ru/ )

• SAI OCL Catalog King 20
• SAI OCL Catalog King 13
• SAI OCL Catalog Koposov 12

39. APPLICATIONS: Astronomy | Moscow University Supercomputing Center

40. MASTER GLOBAL ROBOTIC TELESCOPES NET