... Moscow Lomonosov State University . ... Consider an open network consisting of N nodes (stations) and V(N) cars, which circulate among the stations. The network is divided into n clusters. ... Cluster j contains d N j N stations, Е j = 1 n d N j = 1. ... Later j and v denote cluster numbers and they take values from 1 to n. The arrival process to a station of cluster j is a Poisson one with the rate l j . ... The destination station in the cluster v is chosen uniformly. ...

Еще в разделе: (Показать все результаты (>52) - old.philol.msu.ru/ )

... Полная версия этой страницы: A large company is looking for Senior J2EE Developer . Студенческий форум Физфака МГУ > Общий > Работа . ... could you please give me the name of company. ...

Еще в разделе: (Показать все результаты (>616) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > A large IT company is looking for J2EE
• Студенческий форум Физфака МГУ > Ph.D. in Large Lakes Observatory (University
• A large IT company is looking for J2EE Developer - Студенческий форум Физфака

. S.I. Kudryashov, N.B. Zorov, A.A. Karabutov, Yu.Ya. Kuzyakov . Mendeleev Commun., v.1, p.22-24 (1997 ) . ABSTRACT . Vaporisation from rough surface areas during the laser ablation of foam graphite under vacuum generates a shock wave of recoil pressure of the vaporised substance which destroys the layer heated by radiation by desorbing large fragments from the material surface. Laboratory of Laser Diagnostics

Еще в разделе: (Показать все результаты (>460) - chem.msu.ru/ )

• Electric probe detection of large cluster ions in spinodal decomposition of the
• Science Department
• Nonstatistical behavior fof IR Multiphoton Dissociation of Molecules

... Large potentials of small heat shock proteins. ... HSPB1 directly or indirectly participates in the regulation of apoptosis, protects the cell against oxidative stress, and is involved in the regulation of the cytoskeleton. ... All small heat shock proteins play important "housekeeping" roles and regulate many vital processes; therefore, they are considered as attractive therapeutic targets. ...

Еще в разделе: (Показать все результаты (>77) - biochem.bio.msu.ru/ )

• Biochemistry Department of Moscow State University | Education
• The role of intrinsically disordered regions in the structure and functioning

When using a large number of Virtual Hosts, Apache may run out of available file descriptors (sometimes called file handles if each Virtual Host specifies different log files. ... Unix operating systems limit the number of file descriptors that may be used by a process; the limit is typically 64, and may usually be increased up to a large hard-limit. ... If you system falls into 1 or 2 (above), then increase the file descriptor limit before starting Apache, using a script like #!/bin/sh . ...

Еще в разделе: (Показать все результаты (>78) - neptun.sai.msu.ru/ )

THE STRATEGY OF TESTS COMPOSITION FOR LARGE GROUPS OF EXAMINEES WITH DIFFERENT LEVELS OF KNOWLEDGE Gavrilov A.I., Gavrilov I.A., Hairjuzova E.V., Shaposhnicova T.L. (Krasnodar) The results of usage criterion of exponential increasing difficulty are discussed, especially in selection of tasks for doing tests in large groups of examinees. It is shown that for the chosen tasks the test results describe as similar distributions in the groups of different level. 304 - .. 10, 2002, .304-305 , . ...

Еще в разделе: (Показать все результаты (>150) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc150888/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc57377/doc.pdf

... Our idea is to virtually commemorate this together around the world with every one of the more than 60 Fulbright alumni association participating with small or large events and in a joined communication of what Fulbright is all about. ... In addition we plan to discuss the plans further throughout the Athens Fulbright conferences in October. ... Thanks to Wiltrud for starting this important conversation about the commemoration of the centenary of Senator Fulbright's birth. ...

Еще в разделе: (Показать все результаты (>105) - www.prof.msu.ru/ )

• WHICH UNIVERSITY SYSTEM IS BEST?
• One effective method to turn passive students into active learners in Russian

... Hobby >> Media >> Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: darktemplar ] . ... 30.09.2006 . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Angren ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Troop ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Anonymous ] . ...

Еще в разделе: (Показать все результаты (>2050) - www.snto-msu.net/ )

... Hobby >> Media >> Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: darktemplar ] . ... 30.09.2006 . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Angren ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Troop ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Anonymous ] . ...

Еще в разделе: (Показать все результаты (>3075) - www.fds-net.ru/ )

• У кого есть Sims hot date или Livin'large или еще что-нибудь?? - Public forum
• Серьезные картинки - Public forum of MSU united student networks

... Поступление в лабораторию . ... Электронный журнал "Компьютерная графика и мультимедиа" . Учебные курсы лаборатории . ... Large-lexicon attribute-consistent text recognition in natural images . ...

Еще в разделе: (Показать все результаты (>150) - graphics.cs.msu.ru/ )

• A system for large-scale automatic traffic sign recognition and mapping |

День Физика . ... Новости . ... Абитуриентам . ... Главная Новости Наука . ... Новости сайта . ...

Еще в разделе: (Показать все результаты (>3) - www.dubinushka.ru/ )

... Air pollution induced changes in pine needle chemistry were observed at sample sites in the surroundings of the Pechenganikel smelter. ... Close to the pollution source needles were enriched in Ni and Cu by needle age. Correlation and principal component analyses show that changes in the element composition of pine needles depended on air pollution and on natural factors as well. The contribution from air pollution increased with needle age. ...

Еще в разделе: (Показать все результаты (>21) - eco.soil.msu.ru/ )

. The work is supported by the Russian Foundation for Basic Research, grant 10-07-00685-a . PDB . Classification . Domain instances . Bonded with NA . 1BMV . VIRUS/RNA . 1 . 0 . 1PGL . VIRUS/RNA . 1 . 1 . total (2 entries) . 2 . 1 . No comments on this family . Send your questions and comments to sas@belozersky.msu.ru .

Еще в разделе: (Показать все результаты (>177) - monkey.belozersky.msu.ru/ )

• SCOP classification

. Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . Тема обращения: . Описание проблемы: . Введите почтовый адрес: . Войти в систему . Регистрация . Главная . Поиск . Статистика . О проекте . Помощь . Издательство: Institute of Electrical and Electronics Engineers . Местоположение издательства: United States . ї 2011-2015 НИИ механики МГУ . Лаборатория 404. Все права защищены.

Еще в разделе: (Показать все результаты (>1483) - istina.msu.ru/ )

• Ravussin P.A. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• M?gi M. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Skopal A. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

J/AstL/vol/page SAI Open Clusters Catalog (Glushkova+, 2009) ================================================================================ Automated search for star clusters in large multiband surveys. ... Color excesses E(B-V), distance moduli and ages were determined for 141 new and 27 known, but poorly studied clusters. We present the Sternberg Astronomical Institute Open Clusters Catalog (SAI OCL Catalog) of coordinates, diameters and main physical parameters of these clusters. ...

Еще в разделе: (Показать все результаты (>219) - ocl.sai.msu.ru/ )

• SAI OCL Catalog Publications

... The role of wine tax-farming system in the forming of large capitals in Russia in the 19th century, . ... The article is devoted to one of the most profitable business activities in Russia at the end of the 18th century to the beginning of the 1860s. The author researches the social and national structure of wine tax-farmers, the level of their incomes as well as the ways and methods of accumulation of capital, in particular, their ties with the aristocracy and state officials of all levels. ...

Еще в разделе: (Показать все результаты (>110) - hist.msu.ru/ )

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>1597) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.fbb.msu.ru/~alex2308/align/delta_aligned.fasta

Projects . ... SmpB . During trans- translation, stalled bacterial ribosomes are rescued by small protein B ( SmpB ) and by transfer-messenger RNA (tmRNA). ... We present evidences that SmpB binds the large and small ribosomal subunits in vivo and in vitro . ... SmpB contacts the large subunit transiently and early during the trans -translational process. The affinity of SmpB for the two ribosomal subunits is modulated by tmRNA in the course of trans -translation. ...

Еще в разделе: (Показать все результаты (>32193) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% ( vs. 1) - TWiki
• SmpB - Projects - TWiki - (printable)
• TinyMCEQuickHelp - TWiki - TWiki

The Ecological Cooperation Project is the first large-scale children's network project in Russia. This project was founded on the principles of development and achievement of widespread nature awareness among Russian school children through the establishment and unification of numerous childrenтАЩs ecological projects. ... Nature Protected Areas . ... The Project is open for cooperative learning, and any childrenтАЩs ecological organization or group is welcome to participate. ...

Еще в разделе: (Показать все результаты (>8) - www.ecocoop.ru/ )

... The First (Experimental) International Astronomy Olympiad . The following olympic problems were proposed for the participants on the theoretical part: Grades 8-10 . ... Why is it sometimes better to use a small telescope in orbit around the Earth than it is to use a large telescope on a mountain top? ... What will an observer looking to the Moon through the telescope see? ... Paper with a drown circle and table of maximal elongations of Mercury and Venus had been done for participants. ...

Еще в разделе: (Показать все результаты (>15) - www.issp.ac.ru/ )

• The International Olympiad of Euro-Asian Astronomical Society
• II International Astronomy Olympiad, Problems to solve
• Institutes of Chernogolovka