When Apache starts, it connects to some port and address on the local machine and waits for incoming requests. By default, it listens to all addresses on the machine, and to the port as specified by the Port directive in the server configuration. ... There are two directives used to restrict or specify which addresses and ports Apache listens to. ... Listen can be used to make a single Apache server listen to more than one address and/or port. ... Syntax: Listen [ port | IP-address:port ] . ...

Еще в разделе: (Показать все результаты (>109) - neptun.sai.msu.ru/ )

• Mapping URLs to Filesystem Locations - Apache HTTP Server
• Apache module mod_negotiation
• Apache module mod_setenvif

... Steganography can be used to store the data used in the image file (options /E and /X) Proposed directory for placement: /pub/os2/apps/graphics Your name: A. Doff Email address: m1@uni-one.nl Program contact name: (same) Program contact email: (same) Program URL: http://home.uni-one.nl/m1 Would you like the contact email address included in listings? no Operating System/Version: OS/2 Additional requirements: Replaces: /pub/os2/apps/graphics/belvoir13.zip ...

Еще в разделе: (Показать все результаты (>3443) - crydee.sai.msu.ru/ )

• http://crydee.sai.msu.ru/ftproot/pub/local/science/publications/aarhus.96/aarhus96.ps.gz
• Image: Nijo castle, Shogun palace. The main building. Comparing to temples and
• Different Fortran standards

... The documentation of NatSkin is crap. ... It does not work (on my TWiki/Cairo installation). ... Why is the sidebar switched off during edit? ... Why are the topic actions named differently compared to standard TWiki? Does NatSkin support QuietSave? ... NatSkin once supported TWiki-2 (Beijing), TWiki-3 (Cairo) and TWiki-4 (Dakar) but has dropped support for Beijing and Cairo since version 3.0. ... Most probably you clicked on "Save" which saved your changes but keept you in the edit process. ...

Еще в разделе: (Показать все результаты (>35132) - dualopt1.cmm.msu.ru/ )

• NatSkinTemplates - TWiki - TWiki
• %TOPICTITLE% (15 vs. 16) - TWiki
• NatSkinTemplates - TWiki - TWiki - (printable)

... Direct syntheses of indium tellurides InTe and In 0.976 Te were carried out in a calorimetric bomb. ... The available information on the enthalpy of formation of indium telluride, InTe, is rather discrepant. ... Robinson et al. /3/ and Jena et al. /4/ used liquid-metal solution calorimetry for the determination of the enthalpy of formation of indium telluride at T=273 K. The results published /3,4/ are -(71.6+1.0) kJ/mol and -71.8 kJ/mol, respectively. ...

Еще в разделе: (Показать все результаты (>938) - chem.msu.ru/ )

• Determination of Reaction Rate Constants in Micelles. A Comparison of the
• The anomalous behaviour of the non-selective ionisation signal pulse under
• Moscow University Chemistry Bulletin Vol. 45, No. 1, P. 51 (2004)

Optimization algorithms for facet models and methods of their network transfer" . R.V. Fedotov . In this paper we describe some methods of geometric optimization for facet models. Algorithms with different degrees of speed-in-action and quality of end results are considered. A method for transferring 3D models through network with a given accuracy and a smooth level of detailing is discussed. ... PostScript (in Russian) (2.30MB) . ... R.V. Fedotov e-mail: fedotov@hotbox.ru ...

Еще в разделе: (Показать все результаты (>284) - num-meth.srcc.msu.ru/ )

• "Shock waves in real gases with different specific heat ratios ahead of and
• "Correction of solar dopplergrams' large-scale flatfield"
• "Calculation of optimal coefficients for quadrature formulas by the complete

... The bright supernova (hereafter SN) in the galaxy NGC 4527 was first sighted by S. Knight (USA) on April 13.17UT at magnitude ~14.0v. The report of the sighting was subsequently forwarded by phone to the AAVSO. ... SN 1991T. The galaxy NGC 4527 is an Sb(s)II type galaxy with an apparent Blue magnitude of 11.32 (Shapley-Ames, 1981). ... An analysis of this event utilizing visual observations by amateurs, plus a light curve is presented.. ... THE LIGHT CURVE: . ... ISN SN 1991T web page . ...

Еще в разделе: (Показать все результаты (>71) - www.rochesterastronomy.org/ )

... The level of expression in Escherichia coli cells and different steps of purification of the recombinant NADP(+)-dependent formate dehydrogenase (EC 1.2.1.2, FDH) from bacterium Pseudomonas sp.101 was analyzed by rapid SDS-Gel capillary electrophoresis (SDS-Gel CE) and compared with SDS polyacrylamide gel electrophoresis (SDS PAGE). ... The molecular mass of the purified FDH was determined as 44,078 Da by matrix-assisted laser desorption/ ionisation time of flight mass spectrometry. ...

Еще в разделе: (Показать все результаты (>142) - www.enzyme.chem.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>179) - www.genebee.msu.ru/ )

• GeneBee BLAST 2.2.8 Services
• GeneBee BLAST 2.2.22+ Services
• The A

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>289) - monkey.belozersky.msu.ru/ )

• About this project

О лаборатории . ... Лаборатория теоретической биофизики . ... Posted by comcon1 in Без рубрики . ... PyMol is a powerful drawing instrument and here we show how to plot Fukui function with PyMOL after two calculation steps with FireFly (PC-GAMESS). continue reading.. ... To build topology for the new molecule partial charges for atoms should be determined. ... OPLS-AA patch for different types of molecules . ... comcon1 in All-atom automatic OPLS-AA topology? . ... 2012 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>59) - erg.biophys.msu.ru/ )

• comcon1 ERG Research Group: Лаборатория теоретической биофизики
• Scanning PES ab initio and in MM ERG Research Group: Лаборатория теоретической
• OPLS-AA patch for different types of molecules ERG Research Group: Лаборатория

Marketing Plan Outline Canada Business Service Centres - CBSCs Last Verified: 2004-11-08 Document No. 4014 Summary A marketing plan is designed to direct company activities towards the satisfaction of customer needs; determine what the customer wants, develop a product/service to meet those needs, get the product/service to the end user and communicate with the customer - at a profit! ... levels, sales volumes? ... What is the consumer acceptance price range for this type of product/service? ...

Еще в разделе: (Показать все результаты (>21) - innovation.msu.ru/ )

• http://www.innovation.msu.ru/english/guidetomarketresearch.doc
• Start-Up Company Development :: Управление инновационной политики и организации

. You can compare any two versions of a file that is under the control of SCCS with the sccsdiff command: /usr/sccs/sccsdiff -r version -r version s. filename . Using this command produces a line by line difference between the two versions of the file. Results are shown in the same format as that produced by the diff command. Examples .

Еще в разделе: (Показать все результаты (>188) - comet.sai.msu.ru/ )

• Comparing directories
• Comparing files
• Physics of the Solar Corona. Seminar 2012 December 20-21

Nominal modification at the Syntax-Semantics Interface: comparing attributive adjectives in Italian and English In his seminal work, Bolinger (1967) discusses an asymmetry between two functions that adjectives can perform, namely attributive and predicative modification; furthermore, he points out that the syntactic asymmetry between the pre- and the post-nominal position of a number of adjectives in English is related to a semantic difference between reference- and referentmodification, respectively. ...

Еще в разделе: (Показать все результаты (>291) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/fdsl/abstracts/romanova.pdf
• http://www.philol.msu.ru/~otipl/new/mscl/2008/abstracts/kashkin.pdf
• FDSL-7.5 | Program

The Department of Talented Youth Affairs and Professional Orientation . ... Law graduates turned in a good performance in the competition ?Foreign Direct Investment Arbitration Moot? ... November 30, 2015, an interactive roundtable meeting on ?Problems of continuous psychological and educational support of gifted children: domestic and foreign experience? was held. ... 2016 - The Department of Talented Youth Affairs and Professional Orientation ...

Еще в разделе: (Показать все результаты (>35) - talant.msu.ru/ )

• Closeout of the educational project ?Literary Evenings? | The Department of
• News | The Department of Talented Youth Affairs and Professional Orientation |

Pentium 4 2.2 GHz . ... Pentium D 3.0 GHz, serial . Pentium D 3.0 GHz, parallel or multithreaded . ... input , output ) . ... Pentium 4 2.2 GHz , P4B (Northwood), 512 Kb L2 cache, no HTT support, 2200 MHz, 400 MHz FSB, 512 MB PC800 RamBus RIMM RDRAM, 60 GB IDE HDD, Windows 2000 Professional SP4. ... Serial - PC GAMESS is running using only one core . Parallel or multithreaded - PC GAMESS is running using only both cores in parallel (tests 1,3,5,6) or multithreaded (tests 2 and 4) modes. ...

Еще в разделе: (Показать все результаты (>96) - classic.chem.msu.su/ )

• Just kidding: PC GAMESS/Firefly v. 7.1.C benchmarks on Atom-based system
• Two years later: Firefly version 8.0.0 beta benchmarks on Intel Core i7 2600K
• Not kidding at all: PC GAMESS/Firefly v. 7.1.E benchmarks on Intel Core

Home :: Seminar in Polymer Physics :: 1998 . ... December 10: K.V.Shaitan (Department of Biology, Moscow State University) . ... November 23: A.L.Borovinsky, A.R.Khokhlov (Physics Department, Moscow State University) . ... October 26: N.L.Levshin, V.B.Zaitzev, S.A.Pestova, G.S.Plotnikov (Physics Department, Moscow State University) . ... April 22: J.P.Rabe (Department of Physics, Humboldt University of Berlin) . ... January 22: E.N.Govorun (Physics Department, Moscow State University) . ...

Еще в разделе: (Показать все результаты (>495) - polly.phys.msu.ru/ )

• CURRICULUM VITAE
• Seminar in Polymer Physics - 2000
• Davidich Maria personal homepage

The method of gene expression analysis in complex morphological systems A.V. Klepikova, N.V. Demidenko, M.D. Logacheva, A.A. Penin M.V. Lomonosov Moscow State University, Moscow, Russia , annklepikova@gmail.com, demidenkonatalia@gmail.com, maria.log@gmail.com, alekseypenin@gmail.com Investigation of gene expression level is a powerful approach in functional genetics. ... 2010) Identification of genes correlated with early stage bladder cancer progression, Cancer Prev Res (Phila), 3(6):776­786. ...

Еще в разделе: (Показать все результаты (>279) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/214.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/237.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/106.pdf

... Research joined under the name ?Nanophotonics of surface states in photonic crystals?, carried out in the laboratory, are aimed to the study of properties of surface electromagnetic waves (SEWs), Tamm plasmon polaritons (TPPs), guided modes, which arise inside or at the surface of photonic crystals. ... We study the force characteristics of the surface states in photonic crystals. ... download . ... Observation of Hybrid States of Tamm and Surface Plasmon-Polaritons in Photonic Crystals" . ...

Еще в разделе: (Показать все результаты (>100) - nanolab.phys.msu.ru/ )

... We estimate that 37 hosts or 11 percent are in this catagory and the highest percentage one could reasonably expect is 89. TELNET RFC --832 833 834 835 836 837 838 839 842 843 845 846 DATE --- Dec Dec Dec Dec Jan Jan Jan Jan Feb Feb Feb Feb ACCEPT -----83 103 102 95 151 171 172 182 183 187 176 190 FTP RFC --832 833 834 835 836 837 838 839 842 843 845 846 DATE --- Dec Dec Dec Dec Jan Jan Jan Jan Feb Feb Feb ...

Еще в разделе: (Показать все результаты (>17424) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc847.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1737.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc1737.txt.pdf

... During Later Cenozoic within Central Asia the series of independently evolving volcanic areas (so-called Central Asian Volcanic Province (CAVP)) has formed [1]. They are Udokan (UVA), Vitim (VVA), Southern Baycalian (SBVA) and Khangai (KVA) volcanic areas. ... Geophysical studies of CAVP [2] revealed presence of large-scale ledge of an asthenospheric mantle (or hot field of mantle) with roof elevated on 100 km to surface. ... End-member component of the basalts from UVA is a weak depleted mantle. ...

Еще в разделе: (Показать все результаты (>902) - geo.web.ru/ )

• Tomographic Models
• Calendar Converter