... The lists of flora of Kem-Ludy archipelago (Russian White Sea, near Arctic Circle) produced in years 1962 and 2001-2004 were investigated by different methods of data analysis. The full species list contains 284 species. 27 islands were studied, four new islands were appeared due to the tectonic events. ... Most important factors are island square and openness (accessibility for winds). ... Marine birds are most important biological factor for island flora maintenance. ...

Еще в разделе: (Показать все результаты (>239) - herba.msu.ru/ )

• Instruction to authors
• Plant evolution on the small islands of the Russian White Sea
• Behaviour of white water-lily flowers in different photoperiods

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>140) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help

Subdeletion structures as additional evidence for different analysis of synthetic and analytic comparatives in Russian In Russian there are two seemingly interchangeable comparative forms of adjectives: synthetic (the suffix -ee) and analytic (the word bolee). ... One more peculiar characteristic pertaining to synthetic rather than analytic comparatives in Russian is the inability of the former to appear in so-called subdeletion structures. ... Masa vyse Vani. i(analytic+GEN). ... Pancheva, Roumyana. ...

Еще в разделе: (Показать все результаты (>273) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/fdsl/abstracts/biskup.pdf
• http://www.philol.msu.ru/~otipl/new/fdsl/abstracts/kuznetsova.pdf

О лаборатории . ... Лаборатория теоретической биофизики . ... OPLS-AA topology generation is a very complex task because of huge amount of the atomtypes described this force field. ... We use OPLS-AA with some includings; ?includings? are overlays on the standart GROMACS forcefield files. ... All-atom automatic OPLS-AA topology generator . ... comcon1 in All-atom automatic OPLS-AA topology? . ... OPLS-AA? in All-atom automatic OPLS-AA topology? ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>59) - erg.biophys.msu.ru/ )

• OPLS ERG Research Group: Лаборатория теоретической биофизики
• topology ERG Research Group: Лаборатория теоретической биофизики

Mindterm Settings This document lists the different configuration options one may set to configure MindTerm. ... Common connection settings protocol Preferred protocol (auto/ssh1/ssh2) server Name of server to connect to port Port on server to connect to real- server Real address of sshd if it is behind a firewall local -bind Default local address to bind to for forwards username Username to login as password Password for normal authentication (only saved if save passwords ...

Еще в разделе: (Показать все результаты (>435) - www.parallel.ru/ )

• Heterogeneous networks and the ch_p4 device | PARALLEL.RU -
• Derived datatypes | PARALLEL.RU - Информационно-аналитический центр по
• Heterogeneous networks of multicomputers and the ch_nexus device | PARALLEL.RU

... Run program . User's guide . Launching program . Input data format . ... Selecting the number of correlated pairs . ... In order to run thr program one needs Java 5.0 environment. ... At the end of computations one will be asked to review the selected number of correlated pairs. ... Note: One may redefine the number of correlated pairs by selecting the 'Edit' -> 'redefine correlated pairs number' menu item. Correlated pairs of positions are presented as a colored matrix, the heatmap. ...

Еще в разделе: (Показать все результаты (>132) - bioinf.fbb.msu.ru/ )

• SDPpred
• SDPlight
• SDPsite - Algorithm Format requirements

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>600) - monkey.belozersky.msu.ru/ )

• About this project
• About COGs
• ETS_all_contacts alignment

... Second set contains blast hits of the contig or the chromosome search against protein database, for example, Uniref90. ... Hit color corresponds to reading frame in the contig, color intensity is grteater than intensities of exons. ... Reading frame of five blast hits in the third exon of gene g4 are different than exon's reading frame . Blast hits in gene g3 located on reverse strand do not match reading frames of the 1st and 3rd exons and overlap 1-2 and 2-3 introns . ...

Еще в разделе: (Показать все результаты (>127) - mouse.belozersky.msu.ru/ )

... Version history . ... Fortran-DVM and C-DVM languages supported data distribution by equal blocks and corresponding distribution of parallel loop iterations (data parallelism). ... A new toolkit - DVM-program performance analyzer was included in the version. ... Fortran-DVM and C-DVM languages support now data distribution by non-equal blocks and parallel executed program section specification (task parallelism). ... The version 3.30 (27.12.2000) is differ from version 3.15 in the following: . ...

Еще в разделе: (Показать все результаты (>91) - sp.cs.msu.ru/ )

... Proceedings of the 4 th Intern.Conf. on Ecologocal Engineering for Wastewater Treatment. ... Taking the lignosulphonates of the different cationic form (Na + , Ca +2 , Al +3 or H + ) and fraction (low molecular mass and colloid fractions) compositions, we considered some series of colloid-chemical phenomena, which are the basic adsorption methods of water purification of cycle wastewater at the factories of wood and paper industries. ... J.Colloid Sci. 1960, v. 15, p. 452. ...

Еще в разделе: (Показать все результаты (>758) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 54, No. 2, P. 102 (2013)
• Moscow University Chemistry Bulletin Vol. 50, No. 4, P. 267 (2009)
• Moscow University Chemistry Bulletin Vol. 48, No. 3, P. 178 (2007)

... 3.0.9 - 3.0.18 only, PHP 4 >= 4.0.0) ImagePSText -- To draw a text string over an image using PostScript Type1 fonts . array imagepstext ( int image, string text, int font, int size, int foreground, int background, int x, int y [, int space [, int tightness [, float angle [, int antialias_steps]]]]) . ... Foreground is the color in which the text will be painted. ... Tightness allows you to control the amount of white space between characters. ... Allowed values are 4 and 16. ...

Еще в разделе: (Показать все результаты (>855) - oit.cmc.msu.ru/ )

• Declaration of the Zend Function Block
• CURL, Client URL Library Functions
• How Directory, Location and Files sections work

... K. Krylov . There was undertaken a research of lengthes of marinon - some integral units obtained by segmenting of comleted (whole) fiction prosaic texts (stories, small novels, novels). ... Overall corpus of considereded texts (Russian fiction prosaic) contain more than two million of graphic running words. Undertaken research has lead us to revealing of three main regularities. 1) to formulation of the law of optimum relation between number of elements within each submicroscopic level; . ...

Еще в разделе: (Показать все результаты (>54) - old.philol.msu.ru/ )

• MSU-LGCLL:: Krylov J.K. - On the Nature of Koehler's Effect

Электронная библиотека Попечительского совета . ... Walrath K., Campione M., Huml A. - JFC Swing Tutorial, The: A Guide to Constructing GUIs . ... Название: JFC Swing Tutorial, The: A Guide to Constructing GUIs . Авторы: Walrath K., Campione M., Huml A. Аннотация: . ... The JFC Swing Tutorial: A Guide to Constructing GUIs provides a hard copy of Sun's popular online tutorial for Swing/JFC development. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>15075) - lib.mexmat.ru/ )

• Goldsmith D.W. - Runaway Universe: The Race to Discover the Future of the
• Nassau K. - Color for Science, Art and Technology :: Электронная библиотека
• Lucas R., Plataniotis K.N. - Color Image Processing. Methods and Applications

... Effect of mutations in the beta5-beta7 loop on the structure and properties of human small heat shock protein HSP22 (HspB8, H11). ... Because conservative Lys residues located in the beta5-beta7 loop and in the beta7 strand appear to play an important role in the structure and properties of HSP22, mutations in this part of the small heat shock protein molecule might have a deleterious effect and often correlate with the development of different congenital diseases. ...

Еще в разделе: (Показать все результаты (>94) - biochem.bio.msu.ru/ )

• Redox-dependent change of nucleotide affinity to the active site of the

... During Later Cenozoic within Central Asia the series of independently evolving volcanic areas (so-called Central Asian Volcanic Province (CAVP)) has formed [1]. They are Udokan (UVA), Vitim (VVA), Southern Baycalian (SBVA) and Khangai (KVA) volcanic areas. ... Geophysical studies of CAVP [2] revealed presence of large-scale ledge of an asthenospheric mantle (or hot field of mantle) with roof elevated on 100 km to surface. ... End-member component of the basalts from UVA is a weak depleted mantle. ...

Еще в разделе: (Показать все результаты (>530) - geo.web.ru/ )

• http://geo.web.ru/conf/alkaline/2009/Kulikova1.htm
• http://geo.web.ru/conf/alkaline/2009/aoifebrady.htm
• http://geo.web.ru/conf/alkaline/2009/Pogrebs.htm

... We have compared visualized fields of GSC and USNO A1.0 catalog with unpublished photographic finding charts that were sent by L. Plaut to the compilers of the GCVS. ... 7-15 A9 --- GCVS GCVS or NSV name 17-25 F9.4 --- GSC GSC number 26 A1 --- NoteFlag *Nonstar (GSC) flag 28-29 I2 h RA2000GSC.h Hours RA (GSC), equinox 2000.0 31-32 I2 min RA2000GSC.m Minutes RA (GSC), equinox 2000.0 34-38 F5.2 s RA2000GSC.s Seconds RA (GSC), equinox 2000.0 40 A1 --- DE2000GSC.- ... Plaut, L., 1966, Bull. ...

Еще в разделе: (Показать все результаты (>111) - sai.msu.ru/ )

• General Catalogue of Variable Stars: Vols I-III (the new electronic version).

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>157) - www.pereplet.ru/ )

с M. H. Shulman . ... of the selected reference frame existence in the Universe . ... This radiation was identified as cosmic microwave background radiation (CMBR) and supposed to be connected with the Universe early process. ... The CMBR temperature deviation map (relative to isotropic value 2.728 К). ... I suppose that any (electromagnetic) radiation is ideally isotropic for an observer (immobile relative to emitter) only at the selected reference frame being unique at the Universe every point. ...

Еще в разделе: (Показать все результаты (>368) - chronos.msu.ru/ )

• Russian Interdisciplinary Temporology Seminar
• TIME AS PROCESS FUNCTION
• Laboratory-chair of modelling the natural references of time

A very important stage in a story of formation of any new science is the shift from discussion of situation which are possible but do not occur in practice due to some reason to recognition of real phenomena of interest. ... We suggest to consider computer viruses as this new specific form of life which is coming in the contact with our form of life. ... Computer life has been created by human being, the role of independent evolution of computer viruses seems to be still negligible. ...

Еще в разделе: (Показать все результаты (>241) - lnfm1.sai.msu.ru/ )

• IDL programs
• Data bases of Natural Satellites. Documentation. Structure
• Data bases of Natural Satellites. Documentation. Manual

... About lab . ... Detection and correction of unnatural purple colors in images of refractive objects taken by digital still camera . ... color calibration , color correction , color management , digital still camera , light dispersion , monochromatic colors , perceptually uniform color spaces , RAW-processing . ... We discovered significant error in color in images produced by a digital still camera used to capture scenes with a special setup of illumination and an object. ...

Еще в разделе: (Показать все результаты (>219) - graphics.cs.msu.ru/ )

• Digital Microscope | Graphics and Media Lab
• Digital Microscope | Лаборатория компьютерной графики и мультимедиа
• Video Matting Benchmark | Graphics and Media Lab Equation Equation Equation