. This page uses frames, but your browser doesn't support them.

Еще в разделе: (Показать все результаты (>62) - chaos.phys.msu.ru/ )

COMPARISON OF CLUSTERING ALGORITHMS FOR SPEAKER IDENTIFICATION Nikolay Lubimov, Evgeny Mikheev, Alexey Lukin Moscow Lomonosov State University, Moscow, Russia In this paper we consider the problem of text-independent speaker identification that refers to acoustic recognition research. ... We have performed the comparison of different clustering methods for speaker identification: the standard K-means clustering, K-means++, Linde-Buzo-Gray, Fuzzy C-means, and Gustafson-Kessel algorithms. ...

Еще в разделе: (Показать все результаты (>184) - imaging.cmc.msu.ru/ )

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... Samus N.N. , Ipatov A.P. , Smirnov O.M. , Kravtsov V.V. , Alcaino G. , Liller W. , Alvarado F. в журнале Astronomy Letters , издательство Maik Nauka/Interperiodica Publishing (Russian Federation) , том 21, ? ...

Еще в разделе: (Показать все результаты (>1484) - istina.msu.ru/ )

• Alvarado F. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Sakhibov F.Kh - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Zeitschrift Fur Physik D-Atoms Molecules and Clusters - журнал | ИСТИНА -

Terrapin Station ---------------- Inspiration move me brightly like a song with scents and colors hold away despair More than this I will not ask faced with mystery's dark advance statements just seem vain at last Some rise, some fall, some climb to get to Terrapin Counting stars by candelight all are dim but one is bright, The spiral light of Venus rising first and shining best Oh! from the northwest corner of a brand new crescent ...

Еще в разделе: (Показать все результаты (>6435) - crydee.sai.msu.ru/ )

• http://crydee.sai.msu.ru/ftproot/pub/comp/os/os2/sai/doc/humor/os2-105.txt
• http://crydee.sai.msu.ru/ftproot/pub/misc/doc/pm5/scantip2.faq
• ApSA courses

... intas:cern-intas03:task5 ]] . THEP . ... T5.MS Windows.. ... The use of the Windows platform for LCG tasks . ... Porting some of the LCG software on the MS Windows .NET platform . ... Study of the VMware as a software for emulation of multi-computer clusters for the LCG purposes. ... Building of Linux computations clusters on a top of Windows computers (under VMware) would be a great benefit for the Russian Tier2 by obtaining an additional power for distributed computations in a batch mode. ...

Еще в разделе: (Показать все результаты (>3671) - theory.sinp.msu.ru/ )

• LanHEP
• intas:cern-intas03:task3 [THEP]
• тЬО intas:cern-intas03:task3 [THEP]

... I. Mean Surface Brightnesses and Integral Color Indices for Bars Gusev A.S. ================================================================================ Abstract: UBVRIJHK surface brightnesses and color indices of bars of galaxies are determined using surface photometry data for 100 barred galaxies (table1.dat). ... J0 Mean surface J0 brightness 46 A1 --- CI- CI sign 47 -50 F1.2 magn/sq.arcsec. U-B)0 (U-B)0 color index 52 -55 F1.2 magn/sq.arcsec. ...

Еще в разделе: (Показать все результаты (>234) - lnfm1.sai.msu.ru/ )

• http://lnfm1.sai.msu.ru/~rastor/Ralf_Bender/imprs_chapter_11_2007_dwarf_galaxies.pdf
• Scientific activity
• Data bases of Natural Satellites. Documentation. Structure

Questions and answers on how to customize the default look of TWiki for your own needs, using style sheets. ... Create a new topic that will contain your new CSS files . Attach 3 new style sheets to the topic . Point the CSS variables in TWiki.TWikiPreferences to your new files: * Set TWIKILAYOUTURL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/layout.css * Set TWIKISTYLEURL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/style.css * Set TWIKICOLORSURL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/colors.css . ...

Еще в разделе: (Показать все результаты (>38066) - dualopt1.cmm.msu.ru/ )

• PatternSkinCssCookbook - TWiki - TWiki
• %TOPICTITLE% (1 vs. 2) - TWiki
• PatternSkinCssCookbook < TWiki < TWiki

... wLake 1.7 . wLake is a tool which allows to identify clusters of a structural water molecules in given superimposed 3D structures. Put your coordinates in PDB format into the text area. Select a distance threshold. Two water molecules from different structures will be concidered as located in the same space point if the distance between centers of oxygen atoms is less than this threshold. ... EACH STRUCTURE INCLUDING ITS WATER MOLECULES MUST BE PRESENTED AS SEPARATE MODEL: EXAMPLE. ...

Еще в разделе: (Показать все результаты (>7005) - mouse.belozersky.msu.ru/ )

• Cluster 15
• Cluster 128
• Cluster 2

Cameras · ­ · · · · · · · · ! MATLAB · MATLAB · Let's design a camera Idea 1: put a piece of film in front of an object Do we get a reasonable image? ... Slide by Steve Seitz Shrinking the aperture Adding a lens A lens focuses light onto the film · Thin lens model: ­ Rays passing through the center are not deviated (pinhole projection model still holds) Slide by Steve Seitz Adding a lens focal point f A lens focuses light onto the film · Thin ...

Еще в разделе: (Показать все результаты (>11) - imaging.cs.msu.ru/ )

• http://imaging.cs.msu.ru/pub/2013.PRIA.Mamaev_Lukin_Yurin.HermiteNLM.en.pdf

... Class . ... Nested classes inherited from class javax.swing.JApplet . ... private int . ... private java.lang.String[] . ... private static int . ... Fields inherited from class javax.swing.JApplet . ... Fields inherited from class java.applet.Applet . Fields inherited from class java.awt.Panel . Fields inherited from class java.awt.Container . Fields inherited from class java.awt.Component . ... Field Detail private static final int VERTICAL . ... private java.lang.String[] classes . ...

Еще в разделе: (Показать все результаты (>183) - angel.cs.msu.su/ )

When reading scientific papers, listening to scientific reports and even looking through usual newspapers and magazines, we sometimes find different funny things. ... The same bands were later observed in the gase phase by Evans, using the technique of intensification by added oxygen. Evans boldly put 50 atm of ethylene in a cell with 25 atm of oxygen. ... This was a real experiment description in a scientific journal.) ...

Еще в разделе: (Показать все результаты (>97) - www.inorg.chem.msu.ru/ )

• CLUSTERS AND EXTENDED METAL-META

The revision of the MASS/DIMM star catalogue N. Shatsky, V. Kornilov March 16, 2008 Abstract The compilation of the (updated) version of the MASS (MASS/DIMM) device target catalogue is described. ... Then the list was cleaned according to following criteria: I. Remove stars too faint for a MASS device. ... Here the color equation of the Sternb erg device was taken: M AS S mag = V mag + 0.45 (B - V ); stars with M AS S mag > 3.2 were removed. ... This was made based on the GCVS4.2 catalogue data. ...

Еще в разделе: (Показать все результаты (>21) - curl.sai.msu.ru/ )

... x25BA; Site pages . x25BA; Calendar . x25BA; April 2016 . Detailed month view: . x25C4; March 2016 | May 2016 x25BA; . ... Global events shown ( click to hide ) . Course events shown ( click to hide ) . Skip Events key . ... Course Skip Monthly view . ... Mon . ... Fri . ...

Еще в разделе: (Показать все результаты (>4) - moodle.ffl.msu.ru/ )

... Create a new topic that will contain your new CSS files . Attach 3 new style sheets to the topic . Point the CSS preference settings in System.DefaultPreferences or Main.SitePreferences to your new files: * Set FOSWIKI_LAYOUT_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/layout.css * Set FOSWIKI_STYLE_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/style.css * Set FOSWIKI_COLORS_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/colors.css . ... The rest of this topic shows examples of small CSS changes. ...

Еще в разделе: (Показать все результаты (>2015) - wiki.cs.msu.ru/ )

• InstantEnhancements < System < Foswiki
• AppendixEncodeURLsWithUTF8 < System < Foswiki

... Create a new topic that will contain your new CSS files . Attach 3 new style sheets to the topic . Point the CSS preference settings in System.DefaultPreferences or Main.SitePreferences to your new files: * Set FOSWIKI_LAYOUT_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/layout.css * Set FOSWIKI_STYLE_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/style.css * Set FOSWIKI_COLORS_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/colors.css . ... The rest of this topic shows examples of small CSS changes. ...

Еще в разделе: (Показать все результаты (>5624) - wiki.cmc.msu.ru/ )

• InstantEnhancements < System < Foswiki
• AppendixEncodeURLsWithUTF8 < System < Foswiki

Next: Notes on Monte-Carlo Simulations Up: No Title Previous: E-P transitions for different . In this section, we describe what the Scenario Machine is and how it works. Monte-Carlo simulations љ of binary star evolution allows one to study the evolution of a large ensemble of binaries and to estimate numbers of binaries at different evolutionary stages simultaneously . ... Notes on Monte-Carlo Simulations . ... Principles of Scenario Machine Operation . ...

Еще в разделе: (Показать все результаты (>511) - xray.sai.msu.ru/ )

• Concluding Remarks and Future Prospects
• Gamma-Ray Bursts
• Parameters of binary compact star evolution

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>135) - bioinf.fbb.msu.ru/ )

• SDPlight
• Site Cluster

This is very short lesson. ... The reason of this is that dynamic load balancing allows the PC GAMESS/Firefly to use coarser-grained parallel algorithms with much less work duplicated across nodes and typically with much more efficient, optimized memory access patterns. ... To activate dynamic load balancing, just add the following line to your PC GAMESS/Firefly input: . ... Details on the MP2 energy code and p2p interface implementation in the PC GAMESS/Firefly. ...

Еще в разделе: (Показать все результаты (>98) - classic.chem.msu.su/ )

• PC GAMESS v. 7.0.7 benchmarks and scalability on Myrinet Opteron Linux cluster
• PC GAMESS/Firefly DOCUMENTATION - MPI bindings for Windows
• Firefly and PC GAMESS Benchmarks

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>128) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• RNA secondary structure prediction
• GEA :: Gene Expression Analysis

... About 70 scientific papers. The theory of square parachute is created, describing distribution of parameters of shape, tension and resistance to airflow of canopy in steady-state condition for various sets of suspension line lengths and air-permeability. ... The practical recommendations for optimal parachute application are submitted. ... It is discovered experimentally that a character of pressure distribution for a square canopy depends on a particular choice of suspension line lengths. ...

Еще в разделе: (Показать все результаты (>8) - margaret.imec.msu.ru/ )