... Moscow Lomonosov State University . ... Consider an open network consisting of N nodes (stations) and V(N) cars, which circulate among the stations. The network is divided into n clusters. ... Cluster j contains d N j N stations, Е j = 1 n d N j = 1. ... Later j and v denote cluster numbers and they take values from 1 to n. The arrival process to a station of cluster j is a Poisson one with the rate l j . ... The destination station in the cluster v is chosen uniformly. ...

Еще в разделе: (Показать все результаты (>50) - old.philol.msu.ru/ )

. of Lomonosov Moscow State University, . Russia . GCVS Research Group . Catalogues of Variable Stars . Future Prospects of Variable-Star Catalogues . B.V. Kukarkin Centenary Conference: Variable Stars, the Galactic Halo and Galaxy formation (VS-Halo) . What's new . Recent publications . Digitization of Moscow Plate Archive . The "Peremennye Zvezdy" (Variable Stars) journal . Send questions and comments to Olga Durlevich .

Еще в разделе: (Показать все результаты (>127) - sai.msu.ru/ )

• WORKSHOP "STELLAR ATMOSPHERES" "THE CHEMICAL AND DYNAMIC EVOLUTION OF STARS AND

COMPARISON OF CLUSTERING ALGORITHMS FOR SPEAKER IDENTIFICATION Nikolay Lubimov, Evgeny Mikheev, Alexey Lukin Moscow Lomonosov State University, Moscow, Russia In this paper we consider the problem of text-independent speaker identification that refers to acoustic recognition research. ... We have performed the comparison of different clustering methods for speaker identification: the standard K-means clustering, K-means++, Linde-Buzo-Gray, Fuzzy C-means, and Gustafson-Kessel algorithms. ...

Еще в разделе: (Показать все результаты (>128) - imaging.cmc.msu.ru/ )

... We used the dataset of 43 complete genomes of organisms from different domains of life (including bacteria, archaea, plants, protists, fungi and animals) to test the idea that it is possible to separate predicted protein-coding genes with different phylogenetic history (putative HGT or contamination) by comparing arrays of protein BLAST bit scores and clustering genes with similar arrays of these scores. ... These sequences are likely candidates for Drosophila to Wolbachia horizontal gene transfer. ...

Еще в разделе: (Показать все результаты (>281) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/177.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/28.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/101.pdf

Supernova 1999cl in M88 . This page is devoted to information on Supernova 1999cl in M88 Basic information on this SN, including the last reported brightness, on this Supernova can be found on the main supernova page. Information on the original web pages for many of these images can be found on the Supernova links web page. ... M1 Supernova Search has a 1999cl page . ... Pedro Re' Animated gif image . ... DAX Observatory . ... vsnet-obs 21040 ] (fwd) Observation of Supernova 1999cl in M88 . ...

Еще в разделе: (Показать все результаты (>270) - www.rochesterastronomy.org/ )

• Supernova 2002bu in NGC 4242
• Supernova 1999gi in NGC 3184
• THE BRIGHT SUPERNOVA 1991T IN NGC 4527; AN AMATEURS PRESPECTIVE

... Shvilkina L.B. , Belega E.D. , Elyutin P.V. , Trubnikov D.N. в журнале Zeitschrift Fur Physik D-Atoms Molecules and Clusters , том 42, ? ... Lhagva O. , Badamdamdin R. , Strakhova Si , Hehnmedeh L. в журнале Zeitschrift Fur Physik D-Atoms Molecules and Clusters , том 27, ? ... Balashov V.V. , Grum-Grzhimailo A.N. в журнале Zeitschrift Fur Physik D-Atoms Molecules and Clusters , том 23, ? ... в журнале Zeitschrift Fur Physik D-Atoms Molecules and Clusters , том 16, ? ...

Еще в разделе: (Показать все результаты (>2266) - istina.msu.ru/ )

• Vlasyuk V.V. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Rautiainen P. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• McGee S.L. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

... Field of research: Extragalactic astronomy. ... NASA Astrophysics Data System (ADS) Abstract Service . ... CADC Home Page . ... CCD Images of Galaxies . ... RUSSIAN LINKS . ... UA Astronomy Personal Home Page - Bill Keel . ... The Shape of the Rotation Curves of Edge-on Galaxies, by A.V.Zasov and A.V.Khoperskov, 2003. ... A Thickness of Stellar Discs, by A.V.Zasov, and D.V.Bizyaev, 2003 . Minimum Velocity Dispersion in Stable Stellar Disks, by A.V.Khoperskov, A.V.Zasov, and N.V.Tyurina, 2003 . ...

Еще в разделе: (Показать все результаты (>100) - neptun.sai.msu.ru/ )

• Running a High-Performance Web Server for BSD

... Windows Compute Cluster Server located at the Microsoft Enterprise Engineering Center. ... Press to visit PC GAMESS v. 7.0.7 benchmarks and scalability on Opteron Myrinet Linux cluster page . Press to visit PC GAMESS v. 7.0.7 benchmarks and scalability on large Opteron Pathscale Infinipath Infiniband Linux cluster page . Press to visit PC GAMESS v. 7.0.4 benchmarks and scalability on SKIF K-1000 (another large Opteron Infiniband Linux cluster) page . ... Press to visit PC GAMESS' Woodcrest vs. ...

Еще в разделе: (Показать все результаты (>102) - classic.chem.msu.su/ )

• Firefly/PC GAMESS standard MP4 benchmark results on modern hardware
• PC GAMESS v. 7.0.7 benchmarks and scalability on Myrinet Opteron Linux cluster
• PC GAMESS benchmarks and scalability on SKIF K-1000 - large Infiniband Opteron

... Chemistry of Coordination Compounds . ... Inorganic Synthesis . ... CLUSTERS AND EXTENDED METAL-METAL BOND SYSTEMS IN INORGANIC COMPOUNDS . ... Cluster compounds, structure & bonding, quantum chemistry . ... Inorganic synthesis, bismuth clusters, metal subhalides . ... inorganic synthesis, clusters, mixed chalcogenides . ... Design, synthesis and investigations of inorganic compounds featuring extended systems of homo- and heterometallic bonds of varying (1D, 2D) dimensionality. ... Kuznetsov . ...

Еще в разделе: (Показать все результаты (>108) - www.inorg.chem.msu.ru/ )

• Inorganic Synthesis Laboratory - Supramolecular and Cluster Compounds

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>24) - observ.pereplet.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>139) - www.genebee.msu.ru/ )

• GEA :: Gene Expression Analysis

astro-ph/0307410 Молекулярный газ в материнской галактике квазара на красном смещении z=6.42 (Molecular Gas in the Host Galaxy of a Quasar at Redshift z=6.42) . ... Authors: R. Klein et al. astro-ph/0307223 Скопление галактик, спрятавшееся за М31:наблюдения RX J0046.4+4204 на XMM-Newton (A Cluster of Galaxies hiding behind M31: XMM-Newton observations of RX J0046.4+4204) . ... обзор hep-ph/0307284 Проверки закона обратных квадратов в гравитации (Tests of the Gravitational Inverse-Square Law) . ...

Еще в разделе: (Показать все результаты (>470) - astro.uni-altai.ru/ )

• http://xray.sai.msu.ru/~polar/sci_rev/1109.html
• http://xray.sai.msu.ru/~polar/sci_rev/1203.html
• http://xray.sai.msu.ru/~polar/sci_rev/1208.html

... Д. л. кДлнйкЙмЦЗ еУТНУ,ТНЛИ ,,УТЫ ТЪ,ВММњИ ЫМЛ,В ТЛЪВЪ ЛП. е.З. гУПУМУТУ, унй нДдйЦ "тдДгД кДллнйьзав" ї кТЪУ ,,ЫВ, Д.л., 1999 , , - , . ... XX , кДлнйкЙмЦЗ Д.л. тдДгД кДллнйьзав Зй ЗлЦгЦззйв 91 , , , . ... 1 -0,4 3 0 0,4 (B-V)0 0,8 1,2 1,6 -2 5 0 7 V 9 2 Mv 4 11 6 M45 13 8 0 0,4 0,8 B-V 1,2 1,6 . ... кДлнйкЙмЦЗ Д.л. тдДгД кДллнйьзав Зй ЗлЦгЦззйв 93 1950 +24њ +22њ +20њ +18њ +16њ +14њ +12њ Ori Ori Ori +6њ 50 40 30 20 10 0 1950 Tau +10њ +8њ 20 10 0 6 h 5h 50 40 30 20 10 0 4h 50 40 +4њ 3h . ...

Еще в разделе: (Показать все результаты (>158) - www.pereplet.ru/ )

• Super Ratio

... There are two methods of describing plant associations of the lake-shore: visual and analytical. ... We analyzed each lake separately with help of cluster analysis (Manchattan distance, Ward method). ... Besides, cluster analysis only for common plant species was performed. ... All common species on this lake form one multitudinous cluster (fig. 5), except for Comarum palustre and Equisetum fluviatile (the same group of species reveled by cluster analysis for common species from other lakes). ...

Еще в разделе: (Показать все результаты (>213) - herba.msu.ru/ )

• The variability of different Drosera
• The behavior of Nymphaea flowers

... Associating polyelectrolytes are macromolecules consisting of soluble charged groups and insoluble groups (stickers) distributed along the chain. ... 1] I.I. Potemkin, V.V. Vasilevskaya, A.R. Khokhlov, " Associating polyelectrolytes: Finite size cluster stabilization versus physical gel formation ", . ... 12] N.N. Oskolkov, I.I. Potemkin, " Complexation in asymmetric solutions of oppositely charged polyelectrolytes: Phase diagram ", Macromolecules 2007 , 40 , 8423-8429 . ... PSMTLab . ...

Еще в разделе: (Показать все результаты (>200) - polly.phys.msu.ru/ )

Next: What UUCP Needs to Up: UUCP Configuration Files Previous: UUCP Configuration Files . ... It is really a hairy subject, and the sometimes terse format of the configuration files doesn't make things easier (although the Taylor format is almost easy reading compared to the older formats in HDB or Version-2). ... Some distributions contain UUCP binaries that have support for both HDB and Taylor configuration enabled, and use different subdirectories for each configuration file set. ...

Еще в разделе: (Показать все результаты (>444) - itpm.msu.su/ )

• Overview of the Directory Tree
• Allocating disk space
• Address Resolution

Summary The subject of the graduation thesis is an experimental study of generation of broadband electromagnetic radiation in cluster jets excited by ultrashort laser pulses. ... We have investigated how terahertz pulse energy scales with various parameters, such as gas backing pressure, the time delay between laser pulse and the opening of the valve, focal spot position relative to the cluster jet, laser pulse chirp sign and duration. ...

Еще в разделе: (Показать все результаты (>118) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2013/Anashkina_Chichigina_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2013/Fedorov_Gordienko_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2008/Golubev_Gordienko_Djidjoev_en.pdf

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . Институт проблем экологии и эволюции им. А.Н. Северцова РАН . Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: compare administrative billion perfumes p . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>5164) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: tax of goods compared that
• Экологический Форум - Фундаментальная Экология: Compare Shopping
• Экологический Форум - Фундаментальная Экология: Compare Prices Online

Correlation Engine Portotype V.Pose, JINR Dubna B.Panzer-Steindel, CERN IT Overview The Correlation Engine Prototype was developed during a 3-month work in CERN IT Division financed by the CERN-Intas project. The CERN monitoring prototype, part of the fabric management work package (WP4) of the DataGrid project, gathers monitoring data from farm nodes in CERN into a central monitoring database. ... Two engines are implemented - ayt and procpu. ... connects to such a node using the ayt engine . ...

Еще в разделе: (Показать все результаты (>48) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/konash/Slides_ACAT2002.doc
• http://acat02.sinp.msu.ru/presentations/nikitin/posterACAT2002.doc

DVM-system of parallel program development . Goals and structure . ... 2.1 C-DVM and Fortran DVM parallel program development . ... Using C-DVM and Fortran-DVM languages a programmer deals with the only version of the program both for sequential and parallel execution. ... These rules are syntactically organized in such a manner that they are "transparent" for standard C and Fortran compilers and doesn't prevent DVM-program execution and debugging on workstations as usual sequential program. ...

Еще в разделе: (Показать все результаты (>89) - sp.cs.msu.ru/ )

• DVM system - in English
• DVM-system. Version history
• Debugging DVM-program. User's guide. Part 1