... 247th American Chemical Society National Meeting and Exposition "Chemistry and materials for energy" , March 16-20, Dallas, TX Talk: A.V. Nemukhin "QM/MM-based modeling of structure and spectra of fluorescent proteins" . ... IV International Symposium "Topical Problems of Biophotonics", July 21-27, Nizhny Novgorod Invited talk: M.G. Khrenova , A.V. Nemukhin, A.P. Savitsky "Molecular modeling of the Forster resonance energy transfer between fluorescent proteins" . ...

Еще в разделе: (Показать все результаты (>15) - lcc.chem.msu.ru/ )

... Next: Window scrolling Up: Dealing with Windows Previous: Dealing with Windows Contents Index . Ordering Windows can be done by two Commands Cascade and Tile from the Menu Window. The Command Cascade will put the Windows one after another in diagonal direction starting from the upper left corner of the Window. The Command Tile put the Windows without intersection one by one from left to right and from up to down. ...

Еще в разделе: (Показать все результаты (>59) - www.spm.genebee.msu.ru/ )

• Subtraction of surfaces of average slope
• Dealing with Windows
• Window scrolling

How to order pictures . The works of our photographers are available for purchase in Books, Posters, Calendars, and as a digital pictures on CD. Click on any of the following sections and choose from a variety of high quality EcoPhoto products. Books . Fine Prints/Posters . Calendars . ... Placing an order is easy. Orders can be made via e-mail, or post. Acceptable forms of payment are cash, money order, and personal check. ... Moscow State University Science Park, . ...

Еще в разделе: (Показать все результаты (>155) - www.fadr.msu.ru/ )

• "EcoPhoto" - Order images - Posters
• Фотоархив "EcoPhoto" - Order images - Posters
• Фотоархив "EcoPhoto" - Order images - Calendars

... О UNИX . ... HelpOnCreoleSyntax . Неизменяемая страница . ... Table of Contents . Headings . ... Contents** (up to the 2nd level) <<TableOfContents(2)>> . ... Parsers <<TableOfContents()>> = heading 1st level = == heading 2nd level == === heading 3rd level === ==== heading 4th level ==== ===== heading 5th level ===== . ... TIME@ inserts date and time of modification {{{ def hello(): print "Hello World!" }}} def hello(): print "Hello World!" {{{ #!python def hello(): print "Hello World!" }}} . ...

Еще в разделе: (Показать все результаты (>65) - uneex.mithril.cs.msu.su/ )

• HelpOnMoinWikiSyntax - UNИX

... О UNИX . ... HelpOnCreoleSyntax . Неизменяемая страница . ... Table of Contents . Headings . ... Contents** (up to the 2nd level) <<TableOfContents(2)>> . ... Parsers <<TableOfContents()>> = heading 1st level = == heading 2nd level == === heading 3rd level === ==== heading 4th level ==== ===== heading 5th level ===== . ... TIME@ inserts date and time of modification {{{ def hello(): print "Hello World!" }}} def hello(): print "Hello World!" {{{ #!python def hello(): print "Hello World!" }}} . ...

Еще в разделе: (Показать все результаты (>239) - uneex.lorien.cs.msu.su/ )

• Apache 2.0 Hook Functions - Apache HTTP Server
• HelpOnMoinWikiSyntax - UNИX
• mod_access - Apache HTTP Server

... PHP 4 >= 4.0.6) mb_detect_order -- Set/Get character encoding detection order . array mb_detect_order ( [mixed encoding-list]) . mb_detect_order() sets automatic character encoding detection order to encoding-list . ... Set detection order by enumerated list */ mb_detect_order("eucjp-win,sjis-win,UTF-8"); /* Set detection order by array */ $ary[] = "ASCII"; $ary[] = "JIS"; $ary[] = "EUC-JP"; mb_detect_order($ary); /* Display current detection order */ echo implode(", ", mb_detect_order()); . ...

Еще в разделе: (Показать все результаты (>257) - oit.cmc.msu.ru/ )

• yp_order
• preg_match_all
• strnatcmp

... Главная -> Фильмы -> The Order . ... Тайна "ордена" . ... В Иерусалиме заљавантюристом сољскандальной репутацией сразу начинают охотиться наемные убийцы иљполиция вољглаве сљотважной Далией Барр, которая нељраз спасет Руди жизнь вољвремя головокружительных погонь иљбешеных перестрелок наљузких улочках древнего города, прежде чемљему удастся разоблачить глобальный заговор безумного главаря ?Ордена? стремящегося начать новую Священную войну иљустановить наљЗемле власть крови иљтеррора. [ klepa ] . ...

Еще в разделе: (Показать все результаты (>467) - kinfo.ru/ )

• The Sin Eater (the Order) - Фильмы - Kinfo.ru
• Law & Order: Trial by Jury - Фильмы - Kinfo.ru
• Out of Order - Фильмы - Kinfo.ru

... The first-order intermolecular perturbation theory developed in the frame of diatomics-in-molecule approach is used to calculate the potential energy surfaces of the Ar.. Cl2 complex in the states which correlate with the X0g+ and B0u+ states of Cl2 fragment. ... Laboratory of Molecular Structure and Quantum Mechanics ...

Еще в разделе: (Показать все результаты (>536) - chem.msu.ru/ )

• PC Crystal Chemistry Analysis of Organic Crystal Structures
• Modeling of Supramolecular Ordering in Molecular Liquids: Structure,
• Конференции 1999-2000

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... ищу Spellforce: Order of Dawn . ... Re: ищу Spellforce: Order of Dawn [ re: KAYZER ] . ... Есть Spellforce: Gold Edition. ... Re: ищу Spellforce: Order of Dawn [ re: Uncorn ] . ...

Еще в разделе: (Показать все результаты (>2616) - www.fds-net.ru/ )

• Money Order в Москве - Public forum of MSU united student networks
• International money order - Public forum of MSU united student networks
• Anarchy results in order - Public forum of MSU united student networks

... Research . ... Our group was established in September, 2006, by members of Laboratory of Nonlinear Optics of Nanostructures and Photonic Crystals (Dr. A.A. Fedyanin and Dr. T.V. Dolgova) and of Laboratory of Scanning Probe Microscopy (Dr. A.A. Ezhov) for development of new directions at the Department of Quantum Electronics, Faculty of Physics. Main activities of the group relate to the nanophotonics and nano-optics of different types of nanostructures including metamaterials. ...

Еще в разделе: (Показать все результаты (>75) - nanolab.phys.msu.ru/ )

• About the laboratory | Лаборатория нанооптики и метаматериалов

... The role of electrostatic interactions on liquid crystalline ordering of polymers has been discussed since famous papers by Onsager. ... As a result, we have predicted orienting action of the electrostatic forces and possibility of weak nematic ordering even in dilute solutions [2]. ... 2] I.I. Potemkin and A.R. Khokhlov, " Nematic Ordering in Dilute Solutions of Rodlike Polyelectrolytes ", J. Chem. ... PSMTLab . ... Chair of Polymer and Crystal Physics; . ...

Еще в разделе: (Показать все результаты (>214) - polly.phys.msu.ru/ )

• PSMTLab - Polyelectrolytes
• Seminar in Polymer Physics - 1997
• Publications of J.A. Martemyanova

... Russian Pages . CDFE: Home Page . ... Numerical data, graphics, and bibliography . ... description] . Last updated: May 6th, 2014 . ... Last updated: June 15th, 2011 . ... Last updated: . ... Last updated: April 4th, 2015 . ... Last updated: February 25th, 2016 . ... Last updated: September 27th, 2011 . ... Photonuclear Data Index since 1955 . ... Last updated: September 15th, 2015 . ... Last updated: March 22th, 2010 . ... Last updated: March 19th, 2015 . ... Last updated: May 15th, 2002 . ...

Еще в разделе: (Показать все результаты (>5237) - cdfe.sinp.msu.ru/ )

... CHIROPTERA BLUMENBACH, 1779 . ... Включает 21 современное семейство, около 200 родов и более 1250 видов; в бСССР 4, 13 и около 52, соответственно. ... Уши различной длины, от просто устроенных (у крыланов) до сложно организованных, с дополнительными лопастями ( козелок и/или противокозелок ), от коротких (менее 1/4 длины предплечья) до очень длинных (примерно равны предплечью). ... Сосков обычно 1 пара (иногда - 2) в подмышечной области, у некоторых семейств развита пара ложных лобковых сосков. ...

Еще в разделе: (Показать все результаты (>1272) - zmmu.msu.ru/ )

• Enigmatic bilophodont molariform tooth from the Eocene of Central Russia
• Tropical centre
• Bats in Internet

... The central file that controls your resolver setup is host.conf. It resides in /etc and tells the resolver which services to use, and in what order. Options in host.conf must occur on separate lines. ... bind for querying the name server . ... A sample file for vlager is shown below: # /etc/host.conf # We have named running, but no NIS (yet) order bind hosts # Allow multiple addrs multi on # Guard against spoof attempts nospoof on # Trim local domain (not really necessary). trim vbrew.com. ...

Еще в разделе: (Показать все результаты (>284) - itpm.msu.su/ )

• Lists in HTML documents
• Apache 2.0 Hook Functions - Apache HTTP Server
• mod_access - Apache HTTP Server

This module is contained in the mod_access.c file, and is compiled in by default. ... allow from env= . deny . ... Syntax: allow from host host .. ... Module: mod_access . The allow directive affects which hosts can access a given directory. ... Example: BrowserMatch ^BadRobot/0.9 go_away <Directory /docroot> order allow,deny allow from all deny from env=go_away </Directory> In this case browsers with the user-agent string BadRobot/0.9 will be denied access, and all others will be allowed. ...

Еще в разделе: (Показать все результаты (>378) - rtm-cs.sinp.msu.ru/ )

• Apache module mod_headers

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Payment method : Mail Order/Fax Order . ... Re: Payment method : Mail Order/Fax Order [ re: PropellerMan ] . ... Re: Payment method : Mail Order/Fax Order [ re: freeze ] . ...

Еще в разделе: (Показать все результаты (>1292) - www.snto-msu.net/ )

• Money Order в Москве - Public forum of MSU united student networks
• Anarchy results in order - Public forum of MSU united student networks
• [T-SQL] Как правильно JOIN'нить таблицу с самой собой? - Public forum of MSU

AC201621_1 [925 - 1275] Candidatus Regiella insecticola clone CUGI_APP_BA-012A24, WORKING DRAFT SEQUENCE, 2 ordered pieces. MLSSITTRKKPQSIANQSRCSWVTNPANCPHSQAASIHTTKVITAKTIGGSKNNAHITIG IKIKAVIKRYFSKRVSPKMLLHRYRQVRVPQNDAHVGQTLPMPFQKQVHQNQARVYL >AC201621_2 [3300 - 3587] Candidatus Regiella insecticola clone CUGI_APP_BA-012A24, WORKING DRAFT SEQUENCE, 2 ordered pieces. ...

Еще в разделе: (Показать все результаты (>1394) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.ru/~tregubova/projects/Term_3/ac201621.orf
• http://kodomo.cmm.msu.ru/~ksenechka91/names.txt
• TracTicketsCustomFields тАУ Tanchiki

... Subarray Datatype Constructor . Up: New Datatype Manipulation Functions Next: Distributed Array Datatype Constructor Previous: True Extent of Datatypes . MPI_TYPE_CREATE_SUBARRAY(ndims, array_of_sizes, array_of_subsizes, array_of_starts, order, oldtype, newtype) . ... IN order] array storage order flag (state) . ... int MPI_Type_create_subarray(int ndims, int array_of_sizes[], int array_of_subsizes[], int array_of_starts[], int order, MPI_Datatype oldtype, MPI_Datatype *newtype) . ... Центры . ...

Еще в разделе: (Показать все результаты (>320) - www.parallel.ru/ )

• Semantics of Nonblocking Communications | PARALLEL.RU -
• Distributed Array Datatype Constructor | PARALLEL.RU -
• Definitions | PARALLEL.RU - Информационно-аналитический центр по параллельным

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... Издательство: Kluwer Academic Publishers . ... в журнале Order , издательство Kluwer Academic Publishers (Netherlands) , том 31, с. 115-120 . ...

Еще в разделе: (Показать все результаты (>3707) - istina.msu.ru/ )

• Steinhauser Matthias - сотрудник | ИСТИНА - Интеллектуальная Система
• Elsukov E.P. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Penin Alexander A. - сотрудник | ИСТИНА - Интеллектуальная Система

An algorithm of variable order and step based on stages of the Dormand-Prince method of the eighth order of accuracy" . Novikov A.E., Novikov E.A. An inequality is obtained to control the stability of the 13-stage Dormand-Prince method of the eighth order of accuracy. ... An algorithm of variable order is formulated. Some numerical results for stiff systems are discussed; these results confirm an efficiency increase of the variable-order method in comparison with a fixed-order scheme. ...

Еще в разделе: (Показать все результаты (>214) - num-meth.srcc.msu.ru/ )

• "On the convergence order of difference schemes for ocean dynamics equations"
• "A three-dimensional family of seven-step Runge-Kutta methods of order six"
• "Quasi-Hermitian splines of second order"