fitshdr - FITS-file headers manipulation tool fitshdr [options] [FITSfile_name] . ... fitshdr [options] --edit FITSfile_name . ... If You want to modify headers of FITSFILE using new FITS-header lines from HEADER file (or from stdin), You have to use this option (You can skip this option, if -H or --header option is used). ... Empty header lines are not displayed (in 'dump' mode only). --line-offsets . ... In 'dump' mode: file offset will be displayed for each header line. --no-line-offsets . ...

Еще в разделе: (Показать все результаты (>214) - lnfm1.sai.msu.ru/ )

• Manpage of FITSHDR_EDIT
• IDL programs
• FITShdr: INSTALL

... Field size . Object name . ... Map size . ... Field size: the approximate size of the map in the Y direction. ... Galaxies: . ... Galaxies, which size exceeds some value depending on the field and map sizes, are displayed with their real positional angles and sizes by 25m isophote. ... In the "tools" fields there are links to the several famous AVO (Astrophysical Virtual Observatory) resources: NED and Simbad databases and DSS2 (Palomar Digitized Sky Survey) images of the corresponding sky area. ...

Еще в разделе: (Показать все результаты (>26645) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"
• Cone Nebula Close Up
• The Flight Of Helios

You are here: Foswiki > System Web > JQueryPlugin > JQueryPNotify (revision 1) E dit A ttach . ... Full featured plugin to show temporary floating messages for status updates, actions and errors. Call $.pnotify(options) to show a notification. ... text : the message text . ... nonblock : true if items below the message should be clickable . ... function called when the message is being initialized . ... function called when the message has been initialized . ... called before a message is closed . ...

Еще в разделе: (Показать все результаты (>2214) - wiki.cs.msu.ru/ )

• JQueryMasonry < System < Foswiki
• JQueryGradient < System < Foswiki
• JQueryUIDialog < System < Foswiki

... Algorithm & . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). The analysis begins with a multiple alignment of a protein family. ... Predict SDPs only . Predict CPs only . Predict SDPs and CPs . Map a pre-identified list of SDPs and/or CPs onto a structure ...

Еще в разделе: (Показать все результаты (>141) - bioinf.fbb.msu.ru/ )

• Alignment example
• SDPsite - Algorithm Format requirements
• Input Formats

All Firefly versions can take optional command line arguments. ... firefly [optional command line options in any order] [optional list of working directories] . ... The list of most widely used command line options is given below: . ... Disables validity check of the command line arguments (e.g., check for valid names of files and directories, etc...) passed to Firefly. ... However, if this option is not given, one must provide the list of working directories when running Firefly in parallel mode. ...

Еще в разделе: (Показать все результаты (>104) - classic.chem.msu.su/ )

• PC GAMESS/Firefly DOCUMENTATION - running in parallel under Windows using WMPI
• PC GAMESS/Firefly DOCUMENTATION - running in parallel under Windows using
• Firefly and PC GAMESS Version History

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>7285) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Alignment example
• NPG-explorer

REPORT ON INTERNATIONAL SOIL SCIENCE CONGRESS (Montpellier, France, August 1998). ... The symposium was concerned with the effects of environmental factors on soil properties and with reconstructing past environments from soil properties. ... Several of the papers assessed the rates of these processes, some of which are matters of international concern for future global food production because they are causing rapid soil degradation. ...

Еще в разделе: (Показать все результаты (>105) - www.fadr.msu.ru/ )

• the paleopedology working group had a conference last year in Mexico on "Global

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>14) - storage.bioinf.fbb.msu.ru/ )

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>29) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search
• ConClus
• Nhunt

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: Cash advance Tips That Are Guaranteed To . ... Turn towards the Small Business Loan Experts <b><a href=http://carboncounter.epawsurvey.co.uk/wiki/index.php/Us er:PreciousC>Energy Efficiency Loans</a></b> If youв?Tre looking for a small company loan, thereв?Ts nice thing about it from Washington. ...

Еще в разделе: (Показать все результаты (>3738) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: About Payday Cash Advance loan!
• Экологический Форум - Фундаментальная Экология: or I wealth (Baxter) Advanced
• Экологический Форум - Фундаментальная Экология: Cash Advance: Quicker Solution

... Source File: mod_negotiation.c . Module Identifier: negotiation_module Content negotiation, or more accurately content selection, is the selection of the document that best matches the clients capabilities, from one of several available documents. ... A type map (a file with the handler type-map ) which explicitly lists the files containing the variants. ... Apache only recognizes encodings that are defined by an AddEncoding directive. ... Content-Language: . ... Module: mod_negotiation . ...

Еще в разделе: (Показать все результаты (>106) - neptun.sai.msu.ru/ )

• Apache Tutorial: .htaccess files
• Apache module mod_example
• Apache Tutorial: Introduction to Server Side Includes

Administration of the Smolensk Region Smolensk University for Humanities Russian Association of Geomorphologists GEOMORPHIC PROCESSES AND GEOARCHAEOLOGY From Landscape Archaeology to Archaeotourism August 27-31, 2012 Moscow- Smolensk , Russia First Circular SCIENTIFIC PROGRAM SUPPORT Moscow St at e University International Association of Geomorphologists St at e Historical Conference venue: Smolensk University for Humanities (SHU) www.shu.ru. ...

Еще в разделе: (Показать все результаты (>217) - www.geogr.msu.ru/ )

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>1180) - monkey.belozersky.msu.ru/ )

• SDPpred
• Example of supporting positions
• SCOP famyli:

... education . ... Thu, 18/07/2013 - 01:09 ? ... С 19 по 22 августа 2013 года в Лондонском центре нанотехнологий состоится седьмая международная студенческая нанотехнологическая конференция . The London Centre for Nanotechnology, a joint venture between University College London and Imperial College London, will be hosting the 7 th INASCON (International Nanoscience Student Conference) from the 19 th ? 22 nd August 2013. ... Registration is open until 1 st August 2013. ...

Еще в разделе: (Показать все результаты (>33) - nano.msu.ru/ )

... To create a Hysteresys calibration file user should do the following: . Nodal points with known distances between them should be marked using poly line (Curve) on the obtained image of a calibration sample. ... Figure 2.12: Table that allow to define points that are needed for calibration plots generation. ... In this case user should obtain two separate calibration files for fast and slow scanning direction(x-calibration Х y-calibration-slow). ... Then we should unite these two files in one. ...

Еще в разделе: (Показать все результаты (>104) - www.spm.genebee.msu.ru/ )

• Предметный указатель
• Index
• Server configuration

... Basic channels . ... To add new channel, You have to select one of the spectral operations from the Operations list, modify or set the operations parameters and select one (for unary operations) or two (for binary operations) parent spectral channels. ... Subset of parameters in parent channel parameters vector . ... Using the left mouse button, mark the speech frames in the recorded speech (white columns in the lower spectral window, corresponding to the parent channel of this speech detector). ...

Еще в разделе: (Показать все результаты (>59) - www.intsys.msu.ru/ )

• Options dialog

Current Issue About us Editors Board of Editors Guidelines Contacts . ... 2015 . ... Ph.D., Associate Professor, Financial University under the Government of the Russian Federation, Moscow, Russian Federation. ... The article is dedicated to the problems of interaction between state and business interests in the innovative development in the form of public-private partnership. ... No material published in this journal may be reproduced in print or in electronic form without a link to "E-journal. ...

Еще в разделе: (Показать все результаты (>151) - ee-journal.spa.msu.ru/ )

... Multi-threaded search engines . ... Unfortunately, most documents on search engines I saw in the Internet were either lists of hyperlinks without any comments, or discussions about how many documents are in the database of ... (here is the name of a search engine) and what method of counting of the number of documents was used. No words about the efficiency, i.e. how many documents on some subject I can find using this search engine, especially in comparison with the other ones. ...

Еще в разделе: (Показать все результаты (>3) - scon155.phys.msu.ru/ )

... Les programmes d?enseignement . ... La page principale > Les programmes d?enseignement > . S?minaires options d??t? . ... le russe des affaires; . ... Les tudiants liront et analyseront des chef-d oeuvres de la po sie russe du ХIХ ХХ mes si cles; ils mettront les spectacles en sc ne et participeront galement aux mini-spectalces fond s sur la base de ce qu ils ont lu. ... Vous apprendrez le vocabulaire professionnel et les structures grammaticales, les plus communes dans le russe d affaires. ...

Еще в разделе: (Показать все результаты (>28) - www.cie.ru/ )

• Les programmes d?enseignement :: CEI
• Study Periods :: Admissions :: CIE
• July ? August 2010

... help(package=rpart): () rpart help.search( topic1 ): topic1 help.start(): HTML- obj2 - edit( obj1 ): obj1 , options(), obj2 fix( obj1 ): , fix( df1 ): df1 read.table( file1 ): save(file= file1 , list=ls() load( file1 ): setwd(...) dir(): , sink( file1 ): file1 sink() source( file1 ): file1 write.table(x1, file1 ): x1 v3): matplot(mat1,mat2): pairs(df1): qqnorm(.. ...

Еще в разделе: (Показать все результаты (>884) - herba.msu.ru/ )

• Wallowa county, OR, August 22-23, 2006
• San-Francisco Botanical Garden, August 2006
• San-Francisco environs, August 2006