Lomonosov Moscow State University . ... Academic Programs . Academic Board . International Cooperation . ... Symbols of the Faculty . ... Academic Life . Academic Departments Programs . ... Bulletin of Moscow University . ... Admission for International Students . ... Faculty of Foreign Languages and Area Studies Lomonosov Moscow State University: . 119192, Russia, Moscow, Lomonosov Str., ... 2000 - 2016 Faculty of Foreign Languages and Area Studies Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>1309) - ffl.msu.ru/ )

... Foswiki::Search::InfoCache - Support package; cache of topic info. ... ObjectMethod finish() . ObjectMethod metacache . ... If _callback is set, that means the caller wants results as soon as they are ready. =_callback_ should be set to a reference to a function which takes _cbdata as the first parameter and remaining parameters the same as 'print'. ... Note: If format is set, template will be ignored. ... This topic: System > WebHome > ReferenceManual > DeveloperDocumentationCategory > PerlDoc . ...

Еще в разделе: (Показать все результаты (>19543) - wiki.cs.msu.ru/ )

• (backlinks in all Webs) TipsOfTheDayAdmin < System < Foswiki
• (backlinks in System Web) TipsOfTheDayAdmin < System < Foswiki
• (backlinks in System Web) WebSearch < System < Foswiki

Open Conference Systems . ... Conference Content Search . All Authors Title Abstract Index terms Full Text . ... January February March April May June July August September October November December 01 02 03 04 05 06 07 08 09 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 0 . ... By default only papers containing all terms in the query are returned (i.e., AND is implied) . Combine multiple words with OR to find papers containing either term; e.g., education OR research . ...

Еще в разделе: (Показать все результаты (>153) - hea.phys.msu.su/ )

• Conference Contact
• About this Conference System
• Submissions

... 32Bits Online: because there's more than one way to compute . New about new versions of computer related stuff . AAA Matilda Web Search . ... Search . ... The Music Database . ... Musicians looking for other musicians (Free Service) . ... The Mac Game Database uses PHP and MySQL . ... Bioinformatics databases at the Montreal Children's Hospital using MySQL . ... DSL providers search with reviews Made with MySQL and Modperl, all pages are generated dynamically out of the MySQL database . ...

Еще в разделе: (Показать все результаты (>459) - itpm.msu.su/ )

• MySQL Reference Manual for version 3.23.10-alpha. - H Description of MySQL

... Fast Facts about the Faculty of Journalism . ... Partners . ... All partners . ... 14.11.2012 Researchers from the Faculty of Journalism, Lomonosov Moscow State University took part in the 4th ECREA (European Communication Research and Education Association) conference. ... 1999-2014 Faculty of Journalism, Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>167) - www.journ.msu.ru/ )

• National association of mass media researchers (NAMMI) (president - Prof. Elena
• The Researchers and Journalists discussed the Pseudo-science at the Faculty of
• News :: Department of Journalism, M. V. Lomonosov Moscow State University <span

... Length = 4702289 Score = 751 bits (1939), Expect = 0.0 Identities = 359/457 (78%), Positives = 409/457 (89%) Frame = -2 Query : 1 MSVQQIDWDLALIQKYNYSGPRYTSYPTALEFSEDFGEQAFLQAVARYPERPLSLYVHIP 60 MS I WDL+LIQKYNYSGPRYTSYPTALEFSED+ E AF QAV RYP+RPLSLYVHIP Sbjct : 3930889 MSEHAIVWDLSLIQKYNYSGPRYTSYPTALEFSEDYNESAFQQAVKRYPQRPLSLYVHIP 3930710 ...

Еще в разделе: (Показать все результаты (>43426) - kodomo.fbb.msu.ru/ )

• http://kodomo.fbb.msu.ru/~element/Term3/blast_3.txt
• http://kodomo.fbb.msu.ru/~element/Term3/pm.txt
• allpy: 027f0f2f5417 /sequence_based_blocks_search/

... Workload balancing in GPU implementation of breadth-first search" . Chernoskutov M.A., Ermakov D.G. Parallel processing of unstructured data ??ІИ?ўІГІВ in a graph-like form can be a severe computational challenge because of significant overheads caused by the irregular nature of graph algorithms and the hardware latency of intensive data access. ... Keywords: breadth-first search, parallel algorithm, graphics processing units . PDF (in Russian) (315KB) . PDF. zip (in Russian) (275KB) . ...

Еще в разделе: (Показать все результаты (>577) - num-meth.srcc.msu.ru/ )

• "A parallel search of equilibrium points in bimatrix games"
• Problems of search for collisions of cryptographic hash functions of the MD
• Implementation of a parallel algorithm for searching the global extremum of a

... The main field of my investigations is stellar spectrophotometry. As a result of scientific activity of our group spectrophotometric catalog was created including energy distribution data on 900 stars in the range 3200-7600AA and 250 stars in the range 6000-10800AA (Voloshina et al., Spectrophotometry of Bright Stars, ed. I.N.Glushneva, 1982, Moscow, Nauka, in Russian). ...

Еще в разделе: (Показать все результаты (>22) - uranus.sai.msu.ru/ )

• Nikolay Bochkarev
• Tatjana Khruzina

Network Working Group T. Howes Request for Comments: 1558 University of Michigan Category: Informational December 1993 A String Representation of LDAP Search Filters Status of this Memo This memo provides information for the Internet community. ... Abstract The Lightweight Directory Access Protocol (LDAP) [1] defines a network representation of a search filter transmitted to an LDAP server. ... This document defines a human-readable string format for representing LDAP search filters. ...

Еще в разделе: (Показать все результаты (>48783) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc1558.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc1960.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1960.txt

. skip to content . [[ calg:dubna07:program ]] . THEP . Trace: . Show page . Recent Changes Sitemap Log In . Choose namespace . [root] . 20years . calg . egee . fcp . feynxml . intas . labs . lcn . lera . mail . news . restricted . rfbr . sclab . staff . wiki . zotov . Media Files . Upload . Search . Thumbnails Rows . Name Date . Apply . Search file name: Search . calg/dubna07/program.txt ?ї Last modified: 03/062007 17:12 by kryukov . Show page Old revisions . Media Manager Back to top .

Еще в разделе: (Показать все результаты (>31929) - theory.sinp.msu.ru/ )

... Recommended values . Start word length . Start length of motiff for Multiple sequence alignment. ... Max N Mismatches . ... Min score . ... Gap parameter . This parameter defines gap scoring. the grater this value is the stronger gap will be panalysed . ... If inforation content of a column is less than given value the column should be not included into alignment. the grater this value is the stronger gap will be panalysed . ... Max loop . Max energy of a helix . ... cgcatagctc cacca . ...

Еще в разделе: (Показать все результаты (>145) - bioinf.fbb.msu.ru/ )

• Prot-DNA-Korr: main page
• SDPlight

Generic list of xUSSR WWW servers . Search FTP-site by Archie . ... AltaVista or use Advanced or simple query form: Search the Web Usenet and Display the Results in Standard Form in Compact Form in Detailed Form . Search in Internet - 200 search systems . DejaNews - the tool for searching Usenet . Search on Russian WWW servers . SIFT - Stanford Information Filtering Tool . ... Inktomi Search Engine . ... CUI W3 Catalog . EINet Web Search . ... Whole Internet Catalog . ...

Еще в разделе: (Показать все результаты (>265) - comet.sai.msu.ru/ )

• Searching for text
• Fast searches with the fgrep utility
• Search backwards

A.Nekipelov Modernization of Basic Research in Russia: Russian Academy of Sciences ( RAS ) Vision Joint Session of Russian Academy of Sciences, Institute of France Academy of Sciences and Academy of Technology of France Paris, 2010, September 28 1 RAS in Russian Basic Science Potential (per cent, 2008) Russian Federation Research Organizations 100,0 RAS 12,7 Overall Personnel ... Who is the main actor in research: an institute or a laboratory? ...

Еще в разделе: (Показать все результаты (>22) - www.mse-msu.ru/ )

... Departments . ... sqi.cmc.msu.ru . ... The Department was established in 2011 in response to the need for amplifying the field of high performance computing (HPC) and technology as well as quantum informatics. ... The Department members fulfill research to address systems and tools design for the parallel programming, the complex problems of mapping the structure of algorithms on the architecture of supercomputers. ... Parallel processing by Prof. Voevodin, 32 lecture hours, 7th semester. ...

Еще в разделе: (Показать все результаты (>253) - en.cs.msu.ru/ )

• International project INARM of EU program Tempus-IV | CMC MSU
• Software Protection: How to Crack Programs, and Defend Against Cracking by
• Laboratory of Difference Methods | CMC MSU

Please enter the lightcurve file name and period search parameters: . Lightcurve file: . ... Apply the Heliocentric correction and convert all dates to Terrestrial Time (TT)? ... Phase range for plots: -0.5 to 1.0 0.0 to 2.0 0.0 to 1.0 . ... Also, the Heliocentric correction cannot be applied to such lightcurves. ... Two period search methods are currently implemented. ... This period search service is also available at the mirror sites: Mirror 1 , Mirror 2 , Mirror 3 , Mirror 4 . ...

36. Search of novel crystalline materials

37. ldap_search

38. Staff Laboratory of Chemical Thermodynamics

39. crydee.sai.msu.ru archive : search

40. SEARCH