... Line: 1 to 1 . ... Line: 100 to 100 . Set the permission of the twiki/data directory and its subdirectories so that files in there are writable by user nobody . ... Set the permission of the twiki/pub directory and all its subdirectories so that files in there are writable by user nobody . ... The twiki/data/*/*.txt,v RCS repository files in the installation package are locked by user nobody . ... Rename file .htaccess.txt in the twiki/bin directory to .htaccess and change it to your needs. ...

Еще в разделе: (Показать все результаты (>41384) - dualopt1.cmm.msu.ru/ )

• PreferencesPlugin - TWiki - TWiki - (printable)
• JSCalendarContrib - TWiki - TWiki
• BreadCrumbsPlugin - TWiki - TWiki - (printable)

... Форумы > Преподаватели > Тема . Автор темы DED . Форумы Список тем Новая тема . 15.09.2000 13:08 . DED . Дорогой Root, Я хотел бы ответить на . Дорогой Root, Я хотел бы ответить на заметки студентов "рейтинг преподов", . ... Ответить Цитировать . ... Приятно, что на мехмате есть преподаватели, которые проявляют интерес к форуму. ... Очень радует, что преподаватели стали писать в форум . ... Сайт работает с 29.08.2000, Copyright 2000 2011 MMOnline.Ru and MMForce.Net, . ...

Еще в разделе: (Показать все результаты (>118) - www.mmonline.ru/ )

. [ Войти ] . Главная -> Фильмы -> .hack//Roots . Пользователи . Демо . Деньги . Фильмы . Форум .hack//Roots . Япония 2006 . отметить . Сериал . Мультфильм . Приключение . Фантастика . Фэнтэзи .

Еще в разделе: (Показать все результаты (>232) - kinfo.ru/ )

• Trees 2: The Root of All Evil - Фильмы - Kinfo.ru
• Root of All Evil - Фильмы - Kinfo.ru
• Roots: The Next Generations - Фильмы - Kinfo.ru

This module provides for logging of the documents which reference documents on the server. ... Module Identifier: referer_log_module . ... RefererIgnore . RefererLog . ... Module: mod_log_referer . The RefererIgnore directive adds to the list of strings to ignore in Referer headers. ... The RefererLog directive sets the name of the file to which the server will log the Referer header of incoming requests. ... Security: if a program is used, then it will be run under the user who started httpd. ...

Еще в разделе: (Показать все результаты (>111) - neptun.sai.msu.ru/ )

• Apache module mod_log_forensic
• Apache module mod_log_common
• Apache Multiple Log Files

Microtus oeconomus . Reevaluation of taxonomic structure of the root vole ( Microtus oeconomus Pallas, 1776, Rodentia, Arvicolidae) from the territory of the former USSR based on evidence from craniometric and molecular data . ... Distinction on western and eastern groups disagrees with molecular data. ... The third group is formed by samples from Chukotka, Alaska and Kamchatka and constitutes the so-called Beringian clade, what is in a good agreement with molecular data. ...

Еще в разделе: (Показать все результаты (>754) - zmmu.msu.ru/ )

• Genetic and cytogenetic variation of African root-rats Tachyoryctes splendens
• Far-Eastern grey voles (Rodentia: Cricetidae: Alexandromys) from Bolshoi

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>283) - monkey.belozersky.msu.ru/ )

• Inquiry information || Formats of alignments
• SDPpred

... It provides for logging of the documents which reference documents on the server. ... Module: mod_log_referer . The RefererIgnore directive adds to the list of strings to ignore in Referer headers. ... Security: if a program is used, then it will be run under the user who started httpd. ... Security: See the security tips document for details on why your security could be compromised if the directory where logfiles are stored is writable by anyone other than the user that starts the server. ...

Еще в разделе: (Показать все результаты (>660) - rtm-cs.sinp.msu.ru/ )

• Example
• Qt Toolkit - qtimage/qtimage.cpp example file
• Apache Multiple Log Files

Installation notes for Slackware Linux 2.3.0. ... INSTALLATION DISKS: You will need installation disks: a "bootkernel" disk and a "root/install" disk. To make your bootkernel/rootdisk combination, you'll have to get a boot kernel and root disk. ... Here's an example: dd if=scsinet of=/dev/(rdf0, rdf0c, fd0, or whatever) obs=18k DISK SETS Once you've made your boot and install disks, you'll need to make the disk sets you wish to install on MS-DOS formatted floppies. ... You don't need those. ...

Еще в разделе: (Показать все результаты (>4370) - crydee.sai.msu.ru/ )

• Dynamic HTML in Communicator
• Long description for example showing how structurally overlapping cells are

You are here: Foswiki > System Web > ReferenceManual > DeveloperDocumentationCategory > PerlDoc (19 Apr 2011, ProjectContributor ) E dit A ttach . See PublishedAPI for packages intended to be used by Plugin and Contrib authors, or browse all packages . ... Child packages Child packages . ... internal package Foswiki::Configure::Root is a Foswiki::Configure::Section . ... Topic revision: r1 - 19 Apr 2011, ProjectContributor . ... Users . ... User Reference . ... Admin Maintenance . ... User Tools . ...

Еще в разделе: (Показать все результаты (>8518) - wiki.cmc.msu.ru/ )

• PreferencesPlugin < System < Foswiki
• FootNotePlugin < System < Foswiki
• (r1) FootNotePlugin < System < Foswiki

Mathematical modeling of hormonal regulation of the plant root tip structure V.V. Lavrekha1, N.A. Omelyanchuk1, V.V. Mironova 1 1, 2 Institute of Cytology and Genetics SB RAS, Novosibirsk, Russia, e-mail: vvl@bionet.nsc.ru; 2 Novosibirsk State University, Novosibirsk, Russia Key words: Arabidopsis thaliana, mathematical modelling, auxin, cytokinin, cell cycle. ... Auxin induces cell divisions in the MZ, while cytokinin promotes cell differentiation in the transition domain. ...

Еще в разделе: (Показать все результаты (>168) - mccmb.belozersky.msu.ru/ )

. Two-sided estimates for number of fixed points of a discrete logarithm / E. A. Grechnikov. //Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. 2012. ? 3. P. 3-8 [Moscow Univ. Math. Bulletin. Vol. 67, N 3, 2012.]. Lower and upper bounds are obtained for an average number of solutions of the congruence g x x (mod p) in nonnegative integer numbers x p-1, where g is a primitive root modulo p . Key words : discrete logarithm, Brizolis problem. ? 3/2012 . Toggle formulas format . (LaTeX / SVG)

Еще в разделе: (Показать все результаты (>543) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika

Two conclusions drawn by the working group at the 1970 Paleopedology Symposium in Amsterdam were that paleosols should be studied by the same methods as those used for present-day soils, and that field recognition should be based on the identification of more than one distinct pedogenic feature (Yaalon, 1971). ... Because paleosols are typically used to interpret past climates and lengths of time of subaerial exposure, a definition based on soil genesis, rather than plant growth, is advocated. ...

Еще в разделе: (Показать все результаты (>128) - www.fadr.msu.ru/ )

floral unit (FU) terminal (apical) bud stem pedicel node internode axial (lateral) bud generative shoot system erminal bud on secondary shoot secondary shoot vegetative shoot system leaf blade petiole adventitious roots hypocotyl main root (taproot) lateral roots root system

Еще в разделе: (Показать все результаты (>170) - herba.msu.ru/ )

• http://herba.msu.ru/shipunov/school/biol_154/2010_2011/lec_08.pdf
• http://herba.msu.ru/shipunov/school/biol_310/2010_2011/presentations/sobande_olive.pdf
• http://herba.msu.ru/shipunov/school/biol_310/2010_2011/presentations/shumaier_asparagus.pdf

... Monshausen G*, Bibikova TN*, Shi C, Weisenseel M, Gilroy S (2007) Oscillations in extracellular pH and reactive oxygen species modulate tip growth of Arabidopsis root hairs. ... Vincent P, Chua M, Nogue F, Fairbrother A, Mekeel H, Xu Y, Allen N, Bibikova TN, Gilroy S, Bankaitis VA (2005) A Sec14p-nodulin domain phosphatidylinositol transfer protein polarizes membrane growth of Arabidopsis thaliana root hairs. ... Bibikova TN, Gilroy S (2008) Role of calcium in root hair growth and development. ...

Еще в разделе: (Показать все результаты (>19) - plantphys.bio.msu.ru/ )

• Курсовые работы 2013
• Мейчик Наталия Робертовна

... Организация программ анализа данных GRAAL представлена на рис.9.1. Наряду с программами для обработки и анализа экспериментальных данных, существует набор программ для моделирования эксперимента. ... Программы анализа данных написаны на языке FORTRAN77, с использованием библиотек GERNlib 2. ... Программы PAW (Physics Analysis Workstation) и ROOT - это интерактивные программы анализа данных и графического представления результатов, с возможностью автоматизации посредством скриптов. ...

Еще в разделе: (Показать все результаты (>138) - nuclphys.sinp.msu.ru/ )

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>6983) - mouse.belozersky.msu.ru/ )

• SVETKA, a program for multiple sequence alignments analysis
• wLake program homepage

данных о себе // режимы работы // старт - приглашения для регистрации, редактирования // регистрация // редактирование (personal_id= password = все в строке запроса) // загрузка файла loadfoto (она же смена файла) // require _once($ GLOBALS [ DOCUMENT_ROOT ]. / mikromag /script/config.php3 ); require _once($ GLOBALS [ DOCUMENT_ROOT ]. / ...

Еще в разделе: (Показать все результаты (>28) - genphys.phys.msu.su/ )

• http://genphys.phys.msu.su/mikromag/script/registraciya.php3
• http://genphys.phys.msu.su/mikromag/script/forgotpass_user.php3

... Кафедра . ... Электронные ресурсы, доступные из сети ВМК МГУ . Доступ к электронным текстам научных журналов из сети МГУ . Служба технической поддержки факультета ВМК МГУ . ... Кафедра автоматизации научных исследований факультета ВМК МГУ создана в 1988 г. на основе коллектива сотрудников, выделившегося из состава кафедры математической физики (ранее ? ... Под его руководством на кафедре велся широкий круг исследований в области компьютерного моделирования сложных систем и процессов. ...

Еще в разделе: (Показать все результаты (>21) - ani.cmc.msu.ru/ )

• Department of the Automation for Scientific Research CMC MSU | Computational
• Prof. Dmitry P. Kostomarov at the Differential Equations and Topology...
• студентам-геологам | Кафедра автоматизации научных исследований ВМК МГУ

... As a point of departure consider Russian data, where nouns denoting male individuals are always masculine (1a), while nouns denoting female individuals are always feminine (1b). (1) a. xorСs-ij good-MASC.N. `good father' SG ot'Иc father.N. SG (MASC b. xorСs-aja ) good-FEM.N.SG `good mother' mАt' mother.N. SG (FEM ) Thus, we can predict grammatical gender of a noun (`masculine' or ` feminine') on the basis of its semantics (`male' or `female') (Corbett 1991). ... Halkomelem lacks n-GENDER. ...

Еще в разделе: (Показать все результаты (>247) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/main/people/kibrik-aa/files/Lexical_semantics@ALT_2003.pdf
• http://www.philol.msu.ru/~languedoc/tools/text-conv/interlinear-office_mm-to-span.xsl.txt

... Next: COM-port initialization file format Up: Scanning Probe Microscopy Image Previous: Software Installation Contents Index . File is written in text format and consists from one section. ... A record has following format: <voltage>=<temperature>; . ... Example of temperature initialization file listed below. [temperature] -3.00=27.5; -2.67=28.0; -2.33=29.0; -2.00=31.5; -1.67=33.5; -1.33=36.0; -1.00=37.0; -0.67=39.0; -0.33=42.0; 0.00=42.5; 0.33=45.0; 0.67=47.5; 1.00=49.0; 1.33=50.0; 3.00=60.0; . ...

Еще в разделе: (Показать все результаты (>82) - www.spm.genebee.msu.ru/ )

• COM-port initialization file format
• Format of Legend
• Differential filters