... The color indicates how the file is affected by the changeset . [[span( style = background :#bfb;border: 1px solid # 999 ;font-size:80%;margin-right:. 5em ,`€а `)]] Green: Added \\ [[span( style = background :#f88;border: 1px solid # 999 ;font-size:80%;margin-right:. 5em ,`€а `)]] Red: Removed \\ [[span( style = background :#fd8;border: 1px solid # 999 ;font-size:80%;margin-right: ... If a region was modified, the old version is displayed above the new version. ...

Еще в разделе: (Показать все результаты (>1574) - kodomo.cmm.msu.ru/ )

• TracChangeset тАУ Tanchiki
• Script
• TracSyntaxColoring тАУ Tanchiki

Mammuthus primigenius . Unusual tooth pathology in mammoth ( Mammuthus primigenius ) from Yakutia . ... Five pathologically modified last generation lower teeth of the wooly mammoth Mammuthus primigenius from Alazeya River basin (Yakutia) and Maly Anyui River basin (Chukotka) are studied. The described aberrations represent variants of the same pathology of tooth germ. ... Ancient elephants of the USSR] // Trudy Paleontologicheskogo Instituta AN SSSR. ... P.1-78 [in Russian]. ...

Еще в разделе: (Показать все результаты (>1234) - zmmu.msu.ru/ )

• Cranial morphology of five felids: Acinonyx jubatus, Panthera onca, Panthera
• Epigenetic variation of the common shrew, Sorex araneus, in different habitats

... This memo describes the de facto standard Digest Message Format. ... The header of a digest message should identify the digest in the Wancho [Page 1] RFC 1153 Digest Message Format April 1990 Subject line by listname, the key word, Digest, the volume number (usually a sequential number either starting at 1 or the last two digits of the year and incremented by one starting with the first issue of the next calendar year), and an issue number starting at one for the first issue of a new calendar year. ...

Еще в разделе: (Показать все результаты (>16626) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc1153.txt.pdf
• http://mirror.msu.net/pub/slackware-current/slackware/l/babl-0.1.14-i586-1.txt
• http://mirror.msu.net/pub/gentoo-portage/skel.ebuild

... About lab . ... This project is dedicated to enhancement of microscopic images and related problems in order to simplify further analysis (by human or by computer) of such images. ... However, images acquired using described system, have a number of drawbacks, such as limited dynamic range of luminance or limited depth of field. ... The sharpest parts are selected from different images and combined together on resulting image with extended depth of field (see pic. ... Pic. ...

Еще в разделе: (Показать все результаты (>212) - graphics.cs.msu.ru/ )

• Digital Microscope | Лаборатория компьютерной графики и мультимедиа
• GML LidarK Library | Graphics and Media Lab
• Detection and correction of unnatural purple colors in images of refractive

Cameras · ­ · · · · · · · · ! MATLAB · MATLAB · Let's design a camera Idea 1: put a piece of film in front of an object Do we get a reasonable image? ... Slide by Steve Seitz Shrinking the aperture Adding a lens A lens focuses light onto the film · Thin lens model: ­ Rays passing through the center are not deviated (pinhole projection model still holds) Slide by Steve Seitz Adding a lens focal point f A lens focuses light onto the film · Thin ...

Еще в разделе: (Показать все результаты (>11) - imaging.cs.msu.ru/ )

... Главная -> Фильмы -> When Strangers Appear . ... Фильмы . ... When Strangers Appear . ... Австралия - США - Новая Зеландия 2001 . ... Когда перепуганный, истекающий кровью Мэтт входит в затерянное кафе, которым владеет Бет, там закручивается серия загадочных событий. ... Бет решает спасти Мэтта, но его последующее исчезновение и дальнейшее общение с гостями только еще больше запутывают ситуацию, и Бет все глубже и глубже погружается в пучину их опасных игр. ...

Еще в разделе: (Показать все результаты (>1700) - kinfo.ru/ )

• Red Is the Color of - Фильмы - Kinfo.ru
• Color Of Night - Фильмы - Kinfo.ru
• The Color of Evening - Фильмы - Kinfo.ru

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>119) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help

... Dynamic Chaos and Fractals in Speech Rhythm . ... But it's yet rather surprisingly that this especially physical approach has appeared even more productive for explanation of many effects in such far from an engineering area as stuttering. In this paper we show the large-scale Voice/Unvoice temporal structure of normal and destroyed acoustic speech signal possesses the dynamical regimes set. ...

Еще в разделе: (Показать все результаты (>148) - acs366.phys.msu.su/ )

In memory of Sasha Kuznetsov . Only two days ago I came back from a visit abroad to the sorrowful news that our long-time good colleague and friend, a sparkling and noble personality, Alexander Mikhailovitch Kuznetsov, to me and many others, Sasha, had passed away. ... This applied both to his own realm of molecular charge transfer phenomena but also in his interests in broader areas of condensed matter chemical physics. ... Sasha enjoyed high and increasing international respect. ... Back ...

Еще в разделе: (Показать все результаты (>62) - electr003.chem.msu.ru/ )

• Pages of history: Eh-Film

... Shapley H. - Studies of the Magnitudes in Star Clusters IV. On the Color of Stars in the Galactic Clouds Surrounding Messier II . ... Название: Studies of the Magnitudes in Star Clusters IV. ... Автор: Shapley H. Язык: . ...

Еще в разделе: (Показать все результаты (>8493) - lib.mexmat.ru/ )

• Steiger B., Steiger S.H. - The Gale encyclopedia of the unusual and unexplained
• Jauncey G.E.M. - The Energy Reappearing as Characteristic X-Rays when X-Rays
• Brundage B. - Photoshop Elements 4: The Missing Manual :: Электронная

... Many hydrolytic proteins have quaternary structure and consist of even protomers number. ... Catalytic activity was determined by spectrophotometric method with the use of rhodamine 6G, amount of protein was assayed by Lawry method. ... Lipase surface character was observed by acid-base titration method. ... This method allows to obtain an image of immobilized on mica lipase surface, and this permits to conclude an important role of quaternary structure in lipase catalytic activity regulation. ...

Еще в разделе: (Показать все результаты (>74) - www.msm.biophys.msu.ru/ )

• MSM 2007

Supernova Gallery The purpose of the Bright Supernovae web pages is to provide a place where people can find reference images of Supernovae. ... This is an RGB color image of Supernova 2003gs in NGC 936 Credit: Pablo Canadia . Used by permission. (click on image for full resolution) . ... This is an LRGB color image of Supernova 2003cg in NGC 3169 Credit: Pollux observatory . ... Credit: Nick Suntzeff Used by permission. (click on image for full resolution) . ... Credit: AURA/NOAO Image Library . ...

Еще в разделе: (Показать все результаты (>170) - www.rochesterastronomy.org/ )

• Supernova 1999cl in M88
• Supernova 2004dj in NGC 2403
• Supernova 1999gi in NGC 3184

... Work of a system constructing the exercises with the help of a teacher is described. Algorithms of fragmentation of sound data into phonemes and of analysis of correctness of pronunciation of a student are suggested. ... The authors offer the functioning variant of a system, making it possible to a student to appreciate objectively a degree of correctness of his pronunciation, to classify errors and to listen to a difference of pronunciations of incorrect sounds interactively. ...

Еще в разделе: (Показать все результаты (>49) - www.intsys.msu.ru/ )

... Special features of different systems . ... MPI makes it relatively easy to write portable parallel programs. ... There are two basic types of parallel environments: parallel computers and clusters of workstations. ... The MPICH implementation is designed to hide these differences behind the mpirun script; however, if you need special features or options or if you are having problems running your programs, you will need to understand the differences between these systems. ... Центры . ...

Еще в разделе: (Показать все результаты (>400) - www.parallel.ru/ )

• Using the secure server | PARALLEL.RU - Информационно-аналитический центр по
• Trouble with Input and Output | PARALLEL.RU - Информационно-аналитический центр
• Communicator Constructors | PARALLEL.RU - Информационно-аналитический центр по

... 2, Moscow 123182, Russia Sergey V. Razin Institute of Gene Biology, RAS, Vavilova st. 34/5, Moscow 119334, Russia sergey.v.razin@usa.net In Drosophila, interphase chromosomes are organized in topologically associated domains (TADs) within which chromatin-chromatin interactions are frequent, while interactions across domain borders are rare [1]. ... Here we used Hi-C method [5] to map TADs in four drosophila cell lines of different origin. ... Cell 48:471­84. ...

Еще в разделе: (Показать все результаты (>237) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/135.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/132.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/115.pdf

О лаборатории . ... Лаборатория теоретической биофизики . ... OPLS-AA topology generation is a very complex task because of huge amount of the atomtypes described this force field. ... We use OPLS-AA with some includings; ?includings? are overlays on the standart GROMACS forcefield files. ... All-atom automatic OPLS-AA topology generator . ... comcon1 in All-atom automatic OPLS-AA topology? . ... OPLS-AA? in All-atom automatic OPLS-AA topology? ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>58) - erg.biophys.msu.ru/ )

• topology ERG Research Group: Лаборатория теоретической биофизики
• OPLS ERG Research Group: Лаборатория теоретической биофизики
• OPLS-AA patch for different types of molecules ERG Research Group: Лаборатория

... The legs didn?t ride up high, plenty of shorts get. ... Mixing and matching layers and turning shirts into dresses have the ability to belts are not the same ways things whole new outfits, . ... 7) Turn the radio off. Unless you?re scoping out the sound system, leave the radio off. Is actually why so frequency higher any unusual noises. Maybe even turn the A/C on and off and search for noises there as excellent. ...

Еще в разделе: (Показать все результаты (>148) - elana.sinp.msu.ru/ )

• editor | С Днем Победы!
• The busy new mom hosts a lot of different of programs for I | С Днем Победы!

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>32) - observ.pereplet.ru/ )

... О UNИX . ... HelpOnTables . ... Table Markup . ... General table layout and HTML like options . ... Line breaks within cells . ... Bulleted lists and other complex content within cells To create a table, start & end a new line using the table marker; two 'pipe' characters " || ... top left cell || top right cell || || bottom left cell || bottom right cell || ... Just use CSS-formatted styles and it will be inlined in the generated HTML tag. <style="..."> will put that style info into cell (td) html ...

Еще в разделе: (Показать все результаты (>151) - uneex.mithril.cs.msu.su/ )

• HelpOnProcessingInstructions - UNИX
• HelpOnInstalling/ApacheWithModPython - UNИX
• HelpOnFormatting - UNИX

с M. H. Shulman . ... of the selected reference frame existence in the Universe . ... This radiation was identified as cosmic microwave background radiation (CMBR) and supposed to be connected with the Universe early process. ... The CMBR temperature deviation map (relative to isotropic value 2.728 К). ... I suppose that any (electromagnetic) radiation is ideally isotropic for an observer (immobile relative to emitter) only at the selected reference frame being unique at the Universe every point. ...

Еще в разделе: (Показать все результаты (>379) - chronos.msu.ru/ )

• Russian Interdisciplinary Temporology Seminar
• Ontology of the Universe
• M.Shulman