21. LARGE
... Prev . Next . ... , #NUM!. @k <= 0 @k , #NUM!. Excel. ... A5 11.4, 17.3, 21.3, 25.9 40.1. . ...
[
]
http://uneex.mithril.cs.msu.su/static/GnumericDoc_ru/r5694.html -- 4.1 -- 26.09.2011
[
]
http://uneex.lorien.cs.msu.su/static/GnumericDoc_ru/r5694.html -- 4.1 -- 26.09.2011
:
(
(>311) - uneex.lorien.cs.msu.su/ )
22. [RU-NGI] Fwd: Re: [www.dcache.org #7066] recomendations for large dCache
... Previous message: [RU-NGI] Fwd: Re: [www.dcache.org #7066] recomendations for large dCache installations . Next message: [RU-NGI] Monitoring of our CreamCe . Messages sorted by: [ date ] [ thread ] [ subject ] [ author ] . ... SE ATLAS, > dCache SE 1PB . ... RU-NGI mailing list > RU-NGI at theory.sinp.msu.ru > http://theory.sinp.msu.ru/mailman/listinfo/ru-ngi > -- Best regards, Valery Mitsyn . ...
[
]
http://theory.sinp.msu.ru/pipermail/ru-ngi/2012q2/000495.html -- 9.9 -- 05.04.2012
:
(
(>1628) - theory.sinp.msu.ru/ )
23. Our Partners Laboratory of Chemical Thermodynamics
... Our Partners . ... URALCHEM Holding P.L.C., a company incorporated in Cyprus and the holding company for URALCHEM Group, one of the largest producers of nitrogen and phosphate fertilizers in Russia and the CIS. ... Thermodynamics center of precise calorymetry investigations. ... Facility for the Analysis of Chemical Thermodynamics ( Decterov S.A. ? ... Colloquium on 24.12.12 20 Dec 2012 . ... Laboratory of Chemical Thermodynamics . ... 2000-2016 Laboratory of Chemical Thermodynamics . ...
[
]
http://td.chem.msu.ru/en/research/partners/ -- 55.6 -- 09.04.2016
:
(
(>92) - td.chem.msu.ru/ )
24. History of PHP and related projects
PHP Manual . ... History of PHP . History of PHP related projects . Books about PHP . ... One of the biggest strengths of PHP 3.0 was its strong extensibility features. ... The whole new language was released under a new name, that removed the implication of limited personal use that the PHP/FI 2.0 name held. ... PHP 4.0, based on this engine, and coupled with a wide range of additional new features, was officially released in May 2000, almost two years after its predecessor, PHP 3.0. ...
[
]
http://old.hcs.cmc.msu.ru/php/history.html -- 8.9 -- 03.02.2002
[
]
http://old.master.cmc.msu.ru/php/history.html -- 8.9 -- 03.02.2002
[
]
http://oit.cmc.msu.ru/php/history.html -- 8.9 -- 03.02.2002
:
(
(>254) - oit.cmc.msu.ru/ )
25. Wanda at Large - - Kinfo.ru
. [ ] . -> -> Wanda at Large . . . . . . Wanda at Large . 2003 . . . .
[
]
http://kinfo.ru/Movie/f656e55a-bbff-406a-b09c-00248ff6cb71 -- 7.1 -- 11.04.2016
26. Public administration. Web journal
... Submit your article . ... Public Administration publishes scholarly articles on theory, methodology and practice of management, results of applied research projects in administration, studies of Russian and foreign administration experience, bibliographical reviews and information on conferences, round tables and workshops. ... The journal accepts polemic articles. ... All articles submitted for publication are first reviewed for compliance with the guidelines for article formatting and content. ...
[
]
http://ee-journal.spa.msu.ru/page_5.html -- 22.6 -- 10.04.2016
:
(
(>244) - ee-journal.spa.msu.ru/ )
27. M?gi M. - | -
: \ . ... P.M. , Adam?k P. , Artemyev A.V. , Belskii E. , Both C. , Bure? ... Lehtonen P.K. , Laaksonen T. , Artemyev A.V. , Belskii E. , Berg P.R. , Both C. , Buggiotti L. , Bure? ... Lehtonen P.K. , Laaksonen T. , Artemyev A.V. , Belskii E. , Both C. , Bure? ... : Adamik P. , Artemyev A.V. , Belskii E. , Both C. , Bure? ...
[
]
http://istina.msu.ru/workers/1154330/ -- 70.7 -- 12.04.2016
:
(
(>2388) - istina.msu.ru/ )
28. > A large IT company is looking for J2EE
... : A large IT company is looking for J2EE Developer . > > . ... Design, coding, testing, implementation and production support of enterprise-level J2EE applications; Business analysis, discovery, and technical specification development; J2EE cross-training activities; career- and goal-oriented; . ...
[
]
http://wasp.phys.msu.ru/forum/lofiversion/index.php?t7522.html -- 4.5 -- 11.04.2016
:
(
(>482) - wasp.phys.msu.ru/ )
29. CDFE - Centre for Photonuclear Experiments Data - Home page
... Russian Pages . CDFE: Home Page . ... Numerical data, graphics, and bibliography . ... description] . Last updated: May 6th, 2014 . ... Last updated: June 15th, 2011 . ... Last updated: . ... Last updated: April 4th, 2015 . ... Last updated: February 25th, 2016 . ... Last updated: September 27th, 2011 . ... Photonuclear Data Index since 1955 . ... Last updated: September 15th, 2015 . ... Last updated: March 22th, 2010 . ... Last updated: March 19th, 2015 . ... Last updated: May 15th, 2002 . ...
[
]
http://cdfe.sinp.msu.ru/ -- 22.6 -- 26.02.2016
:
(
(>43) - cdfe.sinp.msu.ru/ )
30. :
... .. . ... . ... . .. () - , . .. . ... 11 2006 175 , . .. ( ). ...
[
]
http://www.sai.msu.ru/ -- 20.7 -- 08.04.2016
[
]
http://sai.msu.ru/ -- 20.7 -- 08.04.2016
:
(
(>159) - sai.msu.ru/ )
31. Formation of large carbon clusters during laser ablation of foam graphite
. S.I. Kudryashov, N.B. Zorov, A.A. Karabutov, Yu.Ya. Kuzyakov . Mendeleev Commun., v.1, p.22-24 (1997 ) . ABSTRACT . Vaporisation from rough surface areas during the laser ablation of foam graphite under vacuum generates a shock wave of recoil pressure of the vaporised substance which destroys the layer heated by radiation by desorbing large fragments from the material surface. Laboratory of Laser Diagnostics
[
]
http://www.chem.msu.ru/eng/publ/MC22.html -- 1.7 -- 27.02.2014
[
]
http://chem.msu.ru/eng/publ/MC22.html -- 1.7 -- 09.04.2016
:
(
(>476) - chem.msu.ru/ )
32. http://acat02.sinp.msu.ru/news.html
... Publication data for the ACAT'2002 Proceedings are available (you may download also a Word file ). ... Information on publication of the ACAT'2002 Proceedings and instructions on submission of contributions are available on our Web site. ... Everybody is invited to send interesting pictures! ... Materials (slides etc) of poster presentations appear in our Web data base (check "Programme" page). ... SLIDES of tutorials are available (check "Tutorials" page, then go to particular tutorial page). ...
[
]
http://acat02.sinp.msu.ru/news.html -- 6.3 -- 28.05.2003
:
(
(>55) - acat02.sinp.msu.ru/ )
33. PDB entries containing domains of the family "Large coat protein"
. The work is supported by the Russian Foundation for Basic Research, grant 10-07-00685-a . PDB . Classification . Domain instances . Bonded with NA . 1BMV . VIRUS/RNA . 1 . 0 . 1PGL . VIRUS/RNA . 1 . 1 . total (2 entries) . 2 . 1 . No comments on this family . Send your questions and comments to sas@belozersky.msu.ru .
[
]
http://monkey.belozersky.msu.ru/npidb/cgi-bin/pfam.pl?acc=PF02247 -- 3.4 -- 04.02.2013
:
(
(>166) - monkey.belozersky.msu.ru/ )
34. The role of wine tax-farming system in the forming of large capitals in Russia
... The role of wine tax-farming system in the forming of large capitals in Russia in the 19th century, . ... The article is devoted to one of the most profitable business activities in Russia at the end of the 18th century to the beginning of the 1860s. The author researches the social and national structure of wine tax-farmers, the level of their incomes as well as the ways and methods of accumulation of capital, in particular, their ties with the aristocracy and state officials of all levels. ...
[
]
http://www.hist.msu.ru/Labs/Ecohist/EZH/2002/gavlin.htm -- 2.2 -- 02.10.2012
[
]
http://hist.msu.ru/Labs/Ecohist/EZH/2002/gavlin.htm -- 2.2 -- 02.10.2012
:
(
(>6402) - hist.msu.ru/ )
35. http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta.fasta
sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...
[
]
http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta.fasta -- 8.4 -- 11.09.2012
[
]
http://kodomo.cmm.msu.ru/~anuta_al/projects/delta.fasta -- 8.6 -- 20.04.2009
:
(
(>1484) - kodomo.cmm.msu.ru/ )
36. Schedule : Nonlinear Acoustics and Flows, Instabilities, Turbulence, and
... Thursday, August 22, 2002 ORAL SESSION . ... Hamilton M. Acoustic Streaming in a Cylindrical Tube . ... Boudlal A. Nonlinear Stability of Roll Waves . ... Interaction of Acoustic and Temperature Fields in Thermoacoustics . ... Sugimoto N. Effects of Spatially Periodic Temperature Distribution on Amplification of Energy Flux of a Nonlinear Acoustic Pulse Propagating in a Gas-Filled Tube . ... Shugaev F. The Role of Acoustic Radiation During the Interaction of a Shock Wave with a Turbulent Flow . ...
[
]
http://acs366.phys.msu.su/isna16/Schedule-section7.htm -- 65.1 -- 10.07.2002
:
(
(>127) - acs366.phys.msu.su/ )
37. View publication | Laboratory of Mathematical Methods of Image Processing
... Publications . ... Laboratory of Mathematical Methods of Image Processing . ... Ridge and tree feature detection on images . Publication type . Conference paper . ... 11-th International Conference "Pattern Recognition and Image Analysis: New Information Technologies" . ... Using the results of scale space ridge detection as primary markup the lines are prolonged up to branch points and restored in places where they are not detected. ... Title = {Ridge and tree feature detection on images}, . ...
[
]
http://imaging.cs.msu.ru/en/publication?id=278 -- 8.0 -- 10.04.2016
[
]
http://imaging.cs.msu.su/en/publication?id=278 -- 8.0 -- 09.04.2016
[
]
http://imaging.cmc.msu.ru/en/publication?id=278 -- 8.0 -- 09.04.2016
:
(
(>824) - imaging.cmc.msu.ru/ )
38. Laboratory of Informatics
Laboratory of Informatics . Head of Laboratory E.S.Polischuk, senior researcher, DSc . ... research guidance of a four year student's project in the Faculty of Geography (N.M. Chernavskaya, DSc) . ... Grant of RFBF (Russian Foundation for Basic Research) 01-03-00332, the head of the project prof. R.B.Rybakov, Institute of Orientalistic (Russian Academy of Science), N. M. Chernavskaya - performer . ... N.M.Chernavskaya, DSc, senior researcher, T.B.Pleskacheva., DSc, senior researcher. ...
[
]
http://www.rcc.msu.ru/nivc/english/about/lab/lab_engl1_7.html -- 11.3 -- 11.12.2014
[
]
http://www.srcc.msu.ru/nivc/english/about/lab/lab_engl1_7.html -- 11.3 -- 11.12.2014
[
]
http://srcc.msu.ru/nivc/english/about/lab/lab_engl1_7.html -- 11.3 -- 11.12.2014
:
(
(>92) - srcc.msu.ru/ )
39. UNIX file system
. A file system is a logical method for organising and storing large amounts of information in a way which makes it easy manage. The file is the smallest unit in which information is stored. The UNIX file system has several important features. Different types of file . Structure of the file system . Your home directory . Your current directory . Pathnames . Access permissions .
[
]
http://comet.sai.msu.ru/UNIXhelp/concepts/fsystem.html -- 2.2 -- 17.01.1997
:
(
(>117) - comet.sai.msu.ru/ )
40. Database: publications on x-ray absorption spectroscopy
XAFS spectroscopy is widely used in physics, materials science, chemistry (especially in catalysis and coordination chemistry), biology, geochemistry and environmental science. ... This is an interface to the Glimpse -based search engine which enables you to find published papers in different fields of x-ray absorption spectroscopy -- XAFS, EXAFS, XANES, NEXAFS, SEXAFS, XEOL, and EXAFS-like phenomena in photoemission, electron-energy-loss spectra and so on. ... Database Search Form . ...
[
]
http://scon155.phys.msu.su/~papers/ -- 3.6 -- 13.03.2010
[
]
http://scon155.phys.msu.ru/~papers/index.html -- 3.6 -- 13.03.2010
:
(
(>3) - scon155.phys.msu.ru/ )