... Previous message: [RU-NGI] Fwd: Re: [www.dcache.org #7066] recomendations for large dCache installations . Next message: [RU-NGI] Monitoring of our CreamCe . Messages sorted by: [ date ] [ thread ] [ subject ] [ author ] . ... Так как мы у себя планируем новую установку для SE ATLAS, я спросил > рекомендации на dCache SE размером 1PB и дальше. ... RU-NGI mailing list > RU-NGI at theory.sinp.msu.ru > http://theory.sinp.msu.ru/mailman/listinfo/ru-ngi > -- Best regards, Valery Mitsyn . ...

Еще в разделе: (Показать все результаты (>1519) - theory.sinp.msu.ru/ )

• intas:cern-intas03:task2 [THEP]
• intas:cern-intas03:task1 [THEP]
• The RU-NGI Second quarter 2012 Archive by thread

... Our Partners . ... URALCHEM Holding P.L.C., a company incorporated in Cyprus and the holding company for URALCHEM Group, one of the largest producers of nitrogen and phosphate fertilizers in Russia and the CIS. ... Thermodynamics center of precise calorymetry investigations.љ ... Facility for the Analysis of Chemical Thermodynamics ( Decterov S.A. љ? ... Colloquium on 24.12.12 20 Dec 2012 . ... Laboratory of Chemical Thermodynamics . ... 2000-2016 Laboratory of Chemical Thermodynamics . ...

Еще в разделе: (Показать все результаты (>92) - td.chem.msu.ru/ )

• Carbamide Laboratory of Chemical Thermodynamics

The Ecological Cooperation Project is the first large-scale children's network project in Russia. This project was founded on the principles of development and achievement of widespread nature awareness among Russian school children through the establishment and unification of numerous childrenтАЩs ecological projects. ... Nature Protected Areas . ... The Project is open for cooperative learning, and any childrenтАЩs ecological organization or group is welcome to participate. ...

Еще в разделе: (Показать все результаты (>8) - www.ecocoop.ru/ )

. [ Войти ] . Главная -> Фильмы -> Wanda at Large . Пользователи . Демо . Деньги . Фильмы . Форум . Wanda at Large . США 2003 . отметить . Сериал . Комедия .

Еще в разделе: (Показать все результаты (>272) - kinfo.ru/ )

• At Large with Geraldo Rivera - Фильмы - Kinfo.ru
• Hero at Large - Фильмы - Kinfo.ru
• Masterchef Goes Large - Фильмы - Kinfo.ru

When using a large number of Virtual Hosts, Apache may run out of available file descriptors (sometimes called file handles if each Virtual Host specifies different log files. ... Unix operating systems limit the number of file descriptors that may be used by a process; the limit is typically 64, and may usually be increased up to a large hard-limit. ... If you system falls into 1 or 2 (above), then increase the file descriptor limit before starting Apache, using a script like #!/bin/sh . ...

Еще в разделе: (Показать все результаты (>72) - neptun.sai.msu.ru/ )

... Полная версия этой страницы: A large IT company is looking for J2EE Developer . Студенческий форум Физфака МГУ > Общий > Работа . ... Design, coding, testing, implementation and production support of enterprise-level J2EE applications; Business analysis, discovery, and technical specification development; J2EE cross-training activities; career- and goal-oriented; . ...

Еще в разделе: (Показать все результаты (>345) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > A large company is looking for Senior J2EE
• Студенческий форум Физфака МГУ > Ph.D. in Large Lakes Observatory (University
• A large IT company is looking for J2EE Developer - Студенческий форум Физфака

... Stationary distribution for the Jacobi equation with a large random curvature parameter" . Illarionov E.A. A generalization of the results obtained previously for the case when the curvature parameter of the Jacobi equation is a random quantity distributed on a large or infinite interval is proposed. ... Keywords: stationary distribution, product of matrices, integral equation, Jacobi equation . ...

Еще в разделе: (Показать все результаты (>143) - num-meth.srcc.msu.ru/ )

• "Automation tools for the documentation of large software packages"
• Parallel partitioning tool GridSpiderPar for large mesh decomposition
• "Computing first-order zeros of analytic functions with large values of

... Moscow Lomonosov State University . ... Consider an open network consisting of N nodes (stations) and V(N) cars, which circulate among the stations. The network is divided into n clusters. ... Cluster j contains d N j N stations, Е j = 1 n d N j = 1. ... Later j and v denote cluster numbers and they take values from 1 to n. The arrival process to a station of cluster j is a Poisson one with the rate l j . ... The destination station in the cluster v is chosen uniformly. ...

Еще в разделе: (Показать все результаты (>46) - old.philol.msu.ru/ )

• Dmitry V. Khmelev: List of Publications

. Kudryashov S.I. , Zorov N.B. Mendeleev Communications, p. 178 (1998). Abstract . The electric probe procedure developed here has made it possible to detect for the first time large cluster ions, the products of spinodal decomposition of the laser-induced labile state of the liquid phase of carbon, with a size up to a million atoms and relative content in the mass distribution of the order of ppm. Laboratory of Laser Diagnostics

Еще в разделе: (Показать все результаты (>391) - chem.msu.ru/ )

• Formation of large carbon clusters during laser ablation of foam graphite
• Publications of the Laboratory of Laser Diagnostics
• Science Department

Visual Images of Patriarch Nikon: An Electronic Gallery" consists of nearly fifty artistic depictions of patriarch Nikon and their full bibliographic citations. 2 The gallery evolved out of my dissertation "Patriarch Nikon's Image in Russian History and Culture" (Western Michigan University, 2004) and embodies my main argument that Nikon's resonance in Russian history remains largely unrecognized because traditional histories ? ... Nikon was officially rehabilitated shortly thereafter in 1682. ...

Еще в разделе: (Показать все результаты (>128) - hist.msu.ru/ )

• The role of wine tax-farming system in the forming of large capitals in Russia

Summary Progress Report 2010 ­ 2014 UNESCO Chair on Global Problems and Emerging Social and Ethical Challenges for Large Cities and Their Population at the Faculty of Global Processes of the Lomonosov Moscow State University Period of activity: September 2010 June 2014 Title of the Chair : UNESCO Chair on Global Problems and Emerging Social and Ethical ... Visit of UNESCO Director-General Irina Bokova at Moscow State University September 9, 2011. ...

Еще в разделе: (Показать все результаты (>61) - fgp.msu.ru/ )

Next: Using a Direct Connection Up: UUCP Configuration Files Previous: How to Dial a . Absurd as it may sound at the first moment, using UUCP to transfer data over TCP not that bad an idea, especially when transferring large amount of data such as Usenet news. ... The corresponding port entry would read: . ... This is the default port number of the UUCP service. Instead of the port number, you may also give a symbolic port name to the service command. ...

Еще в разделе: (Показать все результаты (>356) - itpm.msu.su/ )

• Allocating swap space
• Getting smail Up and Running
• The Internet Protocol

... Hobby >> Media >> Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: darktemplar ] . ... 30.09.2006 . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Angren ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Troop ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Anonymous ] . ...

Еще в разделе: (Показать все результаты (>1055) - www.snto-msu.net/ )

... Hobby >> Media >> Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: darktemplar ] . ... 30.09.2006 . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Angren ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Troop ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Anonymous ] . ...

Еще в разделе: (Показать все результаты (>2027) - www.fds-net.ru/ )

• У кого есть Sims hot date или Livin'large или еще что-нибудь?? - Public forum
• Серьезные картинки - Public forum of MSU united student networks

... Air pollution induced changes in pine needle chemistry were observed at sample sites in the surroundings of the Pechenganikel smelter. ... Close to the pollution source needles were enriched in Ni and Cu by needle age. Correlation and principal component analyses show that changes in the element composition of pine needles depended on air pollution and on natural factors as well. The contribution from air pollution increased with needle age. ...

Еще в разделе: (Показать все результаты (>21) - eco.soil.msu.ru/ )

. Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . Тема обращения: . Описание проблемы: . Введите почтовый адрес: . Войти в систему . Регистрация . Главная . Поиск . Статистика . О проекте . Помощь . Издательство: Institute of Electrical and Electronics Engineers . Местоположение издательства: United States . ї 2011-2015 НИИ механики МГУ . Лаборатория 404. Все права защищены.

Еще в разделе: (Показать все результаты (>1663) - istina.msu.ru/ )

• Kosugi T. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• M?gi M. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Ravussin P.A. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

. The work is supported by the Russian Foundation for Basic Research, grant 10-07-00685-a . PDB . Classification . Domain instances . Bonded with NA . 1BMV . VIRUS/RNA . 1 . 0 . 1PGL . VIRUS/RNA . 1 . 1 . total (2 entries) . 2 . 1 . No comments on this family . Send your questions and comments to sas@belozersky.msu.ru .

Еще в разделе: (Показать все результаты (>331) - monkey.belozersky.msu.ru/ )

• SCOP classification

День Физика . ... Новости . ... Абитуриентам . ... Главная Новости Наука . ... Новости сайта . ...

Еще в разделе: (Показать все результаты (>4) - www.dubinushka.ru/ )

The Department of Talented Youth Affairs and Professional Orientation . ... Projects . ... From 1 to 6 July 2014 there were held the third championship of the ?SanSat in Russia? which took place in Dubna (Moscow) ? ... CanSat is a model of microsatellite weighing about 350 grams. CanSat project started in 1999. ... Participants at the third championship were offered a large educational and excursion programs. ... 2016 - The Department of Talented Youth Affairs and Professional Orientation ...

Еще в разделе: (Показать все результаты (>43) - talant.msu.ru/ )

• MSU CNIR visited the Republic of Korea in the delegation of ?Sport

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>4897) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.fbb.msu.ru/~alex2308/align/delta_aligned.fasta