21. LARGE
... Prev . Next . ... , #NUM!. @k <= 0 @k , #NUM!. Excel. ... A5 11.4, 17.3, 21.3, 25.9 40.1. . ...
[
]
http://uneex.mithril.cs.msu.su/static/GnumericDoc_ru/r5694.html -- 4.1 -- 26.09.2011
[
]
http://uneex.lorien.cs.msu.su/static/GnumericDoc_ru/r5694.html -- 4.1 -- 26.09.2011
:
(
(>276) - uneex.lorien.cs.msu.su/ )
22. The role of wine tax-farming system in the forming of large capitals in Russia
... The role of wine tax-farming system in the forming of large capitals in Russia in the 19th century, . ... The article is devoted to one of the most profitable business activities in Russia at the end of the 18th century to the beginning of the 1860s. The author researches the social and national structure of wine tax-farmers, the level of their incomes as well as the ways and methods of accumulation of capital, in particular, their ties with the aristocracy and state officials of all levels. ...
[
]
http://www.hist.msu.ru/Labs/Ecohist/EZH/2002/gavlin.htm -- 2.2 -- 02.10.2012
[
]
http://hist.msu.ru/Labs/Ecohist/EZH/2002/gavlin.htm -- 2.2 -- 02.10.2012
:
(
(>140) - hist.msu.ru/ )
23. Wanda at Large - - Kinfo.ru
. [ ] . -> -> Wanda at Large . . . . . . Wanda at Large . 2003 . . . .
[
]
http://kinfo.ru/Movie/f656e55a-bbff-406a-b09c-00248ff6cb71 -- 7.1 -- 11.04.2016
24. Large Layered Intrusions
... Publications :: Large Layered Intrusions . ... Chalokwu C.I., Ariskin A.A., Koptev-Dvornikov E.V. (1996) Forward modeling of the incompatible element enrichment at the base of the Partridge River intrusion, Duluth Complex, Minnesota: Magma dynamics in a lower mushy zone. ... Krivolutskaya N.A., Ariskin A.A., Sluzhenikin S.F., Turovtsev D.M. Geochemical Thermometry of Rocks of the Talnakh Intrusion: Assessment of the Melt Composition and the Crystallinity of the Parental Magma. ... read >>] . ... Vol...
[
]
http://geo.web.ru/~ariskin/objects.html?id=intrusions&ln=69 -- 8.6 -- 22.12.2007
:
(
(>532) - geo.web.ru/ )
25. Large transportation networks with finite-dimensional state space. Asimptotic
... Moscow Lomonosov State University . ... Consider an open network consisting of N nodes (stations) and V(N) cars, which circulate among the stations. The network is divided into n clusters. ... Cluster j contains d N j N stations, j = 1 n d N j = 1. ... Later j and v denote cluster numbers and they take values from 1 to n. The arrival process to a station of cluster j is a Poisson one with the rate l j . ... The destination station in the cluster v is chosen uniformly. ...
[
]
http://www.philol.msu.ru/~lex/khmelev/proceedings/vilnus1998.html -- 12.7 -- 28.02.2014
[
]
http://old.philol.msu.ru/~lex/khmelev/proceedings/vilnus1998.html -- 12.7 -- 10.04.2016
:
(
(>49) - old.philol.msu.ru/ )
26. >>
... . ... . ... NASA , , 1999 "Mars Climate Orbiter" "Mars Polar Lander". ... Thermonuclear power-station intended for receipt electrical energy in unlimited (on a large) scale on the basis cheap raw material-water. ... . ... . ... ...
[
]
http://www.nature.web.ru/db/discuss.html?mid=1157415&cur_mid=1189313 -- 23.4 -- 11.04.2016
:
(
(>449) - www.nature.web.ru/ )
27. http://danp.sinp.msu.ru/Seminars_Pdf-filesPresentations/Chechenin_Presentation_5-02-15.pdf
Design of Micrometeoroid/Orbital Debris Impact Shield and Development of Failure Risk Assessment System for Orbital Spacecraft N.G. Chechenin Skobeltsyn Institute of Nuclear Physics Lomonosov Moscow State University Space Debris Growth http://www.nasa.gov/pdf/582393main_OCT-Orbital_ Debris _TAGGED.pdf January 19, 2015 China-Russia Joint Space Science Project Proposals Workshop 2 Space ... Crater formation January 19, 2015 Craters on metal surface from meteoroid particle. ...
[
]
http://danp.sinp.msu.ru/Seminars_Pdf-filesPresentations/Chechenin_Presentation_5-02-15.pdf -- 2887.6 -- 08.02.2015
:
(
(>113) - danp.sinp.msu.ru/ )
28. Formation of large carbon clusters during laser ablation of foam graphite
. S.I. Kudryashov, N.B. Zorov, A.A. Karabutov, Yu.Ya. Kuzyakov . Mendeleev Commun., v.1, p.22-24 (1997 ) . ABSTRACT . Vaporisation from rough surface areas during the laser ablation of foam graphite under vacuum generates a shock wave of recoil pressure of the vaporised substance which destroys the layer heated by radiation by desorbing large fragments from the material surface. Laboratory of Laser Diagnostics
[
]
http://www.chem.msu.ru/eng/publ/MC22.html -- 1.7 -- 27.02.2014
[
]
http://chem.msu.ru/eng/publ/MC22.html -- 1.7 -- 09.04.2016
:
(
(>385) - chem.msu.ru/ )
29. Large potentials of small heat shock proteins.
... Large potentials of small heat shock proteins. ... HSPB1 directly or indirectly participates in the regulation of apoptosis, protects the cell against oxidative stress, and is involved in the regulation of the cytoskeleton. ... All small heat shock proteins play important "housekeeping" roles and regulate many vital processes; therefore, they are considered as attractive therapeutic targets. ...
[
]
http://www.biochem.bio.msu.ru/publications/publication.php?pubmedID=22013208 -- 4.3 -- 02.02.2013
[
]
http://biochem.bio.msu.ru/publications/publication.php?pubmedID=22013208 -- 4.3 -- 02.02.2013
:
(
(>54) - biochem.bio.msu.ru/ )
30. Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR - Public forum
... Hobby >> Media >> Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: darktemplar ] . ... 30.09.2006 . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Angren ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Troop ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Anonymous ] . ...
[
]
http://www.snto-msu.net/showflat.php?Number=7085979&src=&showlite= -- 46.9 -- 10.04.2016
:
(
(>1780) - www.snto-msu.net/ )
31. Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR - Public forum
... Hobby >> Media >> Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: darktemplar ] . ... 30.09.2006 . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Angren ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Troop ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Anonymous ] . ...
[
]
http://www.fds-net.ru/showflat.php?Number=7103544&src=&showlite= -- 46.9 -- 10.04.2016
:
(
(>3207) - www.fds-net.ru/ )
33. Pine Needle Chemistry near a Large Point SO2 Source in Northern Fennoscandia
... Air pollution induced changes in pine needle chemistry were observed at sample sites in the surroundings of the Pechenganikel smelter. ... Close to the pollution source needles were enriched in Ni and Cu by needle age. Correlation and principal component analyses show that changes in the element composition of pine needles depended on air pollution and on natural factors as well. The contribution from air pollution increased with needle age. ...
[
]
http://eco.soil.msu.ru/pollution/annot/P01PWASpoll929.htm -- 3.0 -- 22.01.2003
:
(
(>18) - eco.soil.msu.ru/ )
34. PDB entries containing domains of the family "Large coat protein"
. The work is supported by the Russian Foundation for Basic Research, grant 10-07-00685-a . PDB . Classification . Domain instances . Bonded with NA . 1BMV . VIRUS/RNA . 1 . 0 . 1PGL . VIRUS/RNA . 1 . 1 . total (2 entries) . 2 . 1 . No comments on this family . Send your questions and comments to sas@belozersky.msu.ru .
[
]
http://monkey.belozersky.msu.ru/npidb/cgi-bin/pfam.pl?acc=PF02247 -- 3.4 -- 04.02.2013
:
(
(>378) - monkey.belozersky.msu.ru/ )
36. Large-lexicon attribute-consistent text recognition in natural images |
... About lab . ... Conference "GraphiCon" . Online Journal "Computer graphics and multimedia" (in russian) . ... Large-lexicon attribute-consistent text recognition in natural images . ... Conference Paper . ... Conference Name . ... Project: Text detection and recognition in natural images . ...
[
]
http://graphics.cs.msu.ru/en/node/1122 -- 12.5 -- 09.04.2016
:
(
(>170) - graphics.cs.msu.ru/ )
37. The Ecological Cooperation project is the first large scale childrens
The Ecological Cooperation Project is the first large-scale children's network project in Russia. This project was founded on the principles of development and achievement of widespread nature awareness among Russian school children through the establishment and unification of numerous childrens ecological projects. ... Nature Protected Areas . ... The Project is open for cooperative learning, and any childrens ecological organization or group is welcome to participate. ...
[
]
http://www.ecocoop.ru/about_e.htm -- 6.8 -- 14.03.2001
:
(
(>13) - www.ecocoop.ru/ )
38. http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta.fasta
sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...
[
]
http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta.fasta -- 8.4 -- 11.09.2012
[
]
http://kodomo.cmm.msu.ru/~anuta_al/projects/delta.fasta -- 8.6 -- 20.04.2009
:
(
(>1409) - kodomo.cmm.msu.ru/ )
39. http://lnfm1.sai.msu.ru/~math/docs/ivoa_interop2006.pdf
Storing and accessing the largest astronomical catalogues with the SAI CAS project S. Koposov1,2,3, O. Bartunov2, S. Karpov4 et al2. ... Why we want to build our own Catalogue Access Service The requirements for our CAS system The importance of the Database for the CAS (PostgreSQL & Q3C) The technical realization of CAS What has been already done Example of work TODO Storing and Accessing Astronomical Catalogues Existing projects CDS OpenSkyQuery CASjobs with SDSS They are all really great! ...
[
]
http://lnfm1.sai.msu.ru/~math/docs/ivoa_interop2006.pdf -- 2922.2 -- 22.09.2006
:
(
(>267) - lnfm1.sai.msu.ru/ )
40. FFTW - Footnotes | PARALLEL.RU - -
... FFTW - Footnotes . The output for the multi-dimensional rfftw is a more-conventional array of fftw_complex values, but the format here permitted us greater efficiency in one dimension. ... Unless you use fftwnd to perform one-dimensional transforms, in which case the temporary storage required for in-place transforms is as big as the entire array.) ... The 1D transforms require much more communication. ... Any compiler that enforces this limitation doesn't deserve to link to FFTW. ... . ...
[
]
http://www.parallel.ru/docs/FFTW/fftw_foot.html -- 17.5 -- 09.04.2016
:
(
(>291) - www.parallel.ru/ )