. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>169) - monkey.belozersky.msu.ru/ )

• Example of supporting positions

... Generation of recombinant antibodies and means for increasing their affinity. ... For example, application of recombinant technologies resulted in antibody preparation of high affinity significantly exceeding the initial affinity of natural antibodies. In this review we summarize information about the structure, modes of preparation, and application of recombinant antibodies and their fragments and also consider the main approaches used to increase antibody affinity. ...

Еще в разделе: (Показать все результаты (>30) - biochem.bio.msu.ru/ )

• Generation of superoxide by the mitochondrial Complex I.

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... Orlov I.S. , Moiseeva A.A. , Butin K.P. , Sita L.R. , Egorov M.P. , Nefedov O.M. в журнале Mendeleev Communications , издательство Elsevier BV (Netherlands) , том 4, с. 125-126 . ...

Еще в разделе: (Показать все результаты (>1214) - istina.msu.ru/ )

• Future Generation Computer Systems - журнал | ИСТИНА - Интеллектуальная Система
• IET Renewable Power Generation - журнал | ИСТИНА - Интеллектуальная Система
• IET Generation, Transmission and Distribution - журнал | ИСТИНА -

... file . ... pair-cores/web: substitute example of input with one with more blocks in output . ... 8 blocks3d /wt/ blocks3d - wt . 9 debian /. dep . ... 21 allpy /data/ codes . ... 25 blocks3d /www/input/ conservative_groups . ... 26 blocks3d /www/input/ crc32 . ... 27 blocks3d /www/input/ utf8_encode . ... 28 blocks3d /www/input/ dechex . ... 29 blocks3d /www/input/ json2 . ... 30 blocks3d /wt/files/ js . ... 33 pair_cores / html . ... 34 pair_cores /web/ wc . ... 62 # Input files for tests . ...

Еще в разделе: (Показать все результаты (>18457) - kodomo.fbb.msu.ru/ )

• allpy: a3ffdddb2a72 .hgignore
• allpy: a9d4a06ed103 .hgignore
• allpy: b520e79fd1f4 .hgignore

Described below are two methods for preparing input files with basis sets and ECPs which are not currently built in. ... Put basis sets and ECPs in directories (called here def2_svp_BAS and def2_ecp_ECP but you can call them whatever you want) and copy them to the Firefly directory. ... Both methods can also be used for preparing gamess (us) files - the check runs may not terminate properly due to certain keywords, but a useable file called 'input' is normally generated. ...

Еще в разделе: (Показать все результаты (>76) - classic.chem.msu.su/ )

• PC GAMESS/Firefly DOCUMENTATION - Cube files
• PC GAMESS/Firefly DOCUMENTATION - FAST MATRIX DIAGONALIZATION AND INVERSION
• Firefly for Mac OS X: main page

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... dealing with fuzzy edges . ... Some pixels of source image may be a mixture of background and foreground due to . ... Solution: use Matting to decompose source image to background image, foreground image and transparency map . When extrapolating new views source images don't contain all necessary information to fill occlusions on edges of depth map . ... use current frame to generate missing information . ...

Еще в разделе: (Показать все результаты (>223) - graphics.cs.msu.ru/ )

• Temporal Post-processing Method for Automatically Generated Depth Maps |
• Temporal filtering for depth maps generated by Kinect depth camera | Graphics
• High quality stereo-to-multiview generation | Лаборатория компьютерной графики

... This applet generates an observing list based on an observer's location and time. ... To use this program, enter in your location, and the local times at which you wish to begin and end observing. The date you enter should correspond to the calendar day at the time at which you begin observing. For example, if you wish to observe from 9:37 PM October 23, 2007 until 3:21 AM October 24, 2007, you would enter 21:37 for the starting time, 03:21 for the finish time, and 10/23/2007 for the date. ...

Еще в разделе: (Показать все результаты (>11) - observ.pereplet.ru/ )

... Home > Scientific laboratories > IM . ... The Laboratory of Industrial Mathematics (LIM) headed by Professor V.M. Goloviznin was established in the Faculty of Computational Mathematics and Cybernetics (CMC) of Lomonosov Moscow State University in 2011. ... In the area of energy and space, examples of topical engineering problems LIM is involved in, include the numerical simulation of new-generation atomic plants and computational aeroacoustics. ... Source URL: http://en.cs.msu.ru/laboratories/im . ...

Еще в разделе: (Показать все результаты (>165) - en.cs.msu.ru/ )

• Laboratory of Industrial Mathematics | CMC MSU

... Key carbonatite localities that have been investigated as part of INTAS project 05-1000008-7938 ‘ Diamond and Graphite in Carbonate Magmas ’ are: (1) Western Greenland, where the distribution of kimberlites , lamproites and carbonatites is correlated with depth to a fossil subducted slab (personal communication, Nielsen 2008); (2) the Chagatai Complex of ... Generation of carbonatitic melt through partial melting of carbonated eclogite under mantle conditions. ...

Еще в разделе: (Показать все результаты (>301) - geo.web.ru/ )

• http://geo.web.ru/conf/alkaline/2009/Lokhov.htm

. Numerical methods of research on heat and mass intensification processes in power units. Book “Numerical simulation of vertical intensification of heat transfer in tube packages” . Numerical simulation results of heat transfer intensification on “eddy generating” surfaces with different turbulence models application. Heat and hydrodynamic pattern at flowing over the cylinder with “eddy generating” elements

Еще в разделе: (Показать все результаты (>8) - termogaz.imec.msu.ru/ )

• subsonic dimples_e
• supersonic dimples_e

... However, the development of this technique depends on the availability of high performance transducers adapted to power generation constraints allowing to focus and or steer the ultrasonic energy within the volume to be treated. ... In the case of generating CW or long burst wave, problems to be solved are mainly thermal ones while generating very high pulsed pressure wave demands to solve electrical breakdown and mechanical problems. ...

Еще в разделе: (Показать все результаты (>200) - acs366.phys.msu.su/ )

• Abstract

vkgris@mail.ru The opportunity of detection and diagnostics of nano-object parameters in matter by relativistic electrons x-ray radiation generated in an investigated object is discussed. Polarization bremsstrahlung radiation (PB) of relativistic electrons on matter electrons is considered. ... C60 (60)2 (!) ... Grishin V.K. Polarization radiation from relativistic electrons in matter containing fullerenes// Nuclear instruments and Methods in Physics Research B, 2005, v.227, N 1-2, 82-86. ...

Еще в разделе: (Показать все результаты (>117) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/240809/Pavlovsky.pdf

Wood Plant body Morphology of shoot Introduction to Botany. ... Shipunov BIOL 154.8 Wood Plant body Morphology of shoot Monday test (5 points) 5 Components of bark ( 1) Shipunov BIOL 154.8 Wood Plant body Morphology of shoot Outline 1 Wood Plant body Morphology of shoot Components of shoot Branching Arrangement of leaves 2 3 Shipunov BIOL 154.8 Wood Plant ... Plant Biology. 2nd edition. ... Shipunov BIOL 154.8 ...

Еще в разделе: (Показать все результаты (>6089) - herba.msu.ru/ )

• INTERNATIONAL SYMPOSIUM
• bservations on the population of Epipogium aphyllum
• img_0952.jpg

... Package . Class . ... DimensionSet is an inquiry interface for a collection of Dimensions. Netcdf . ... This abstract class provides a skeletal implementation of the Netcdf interface. ... A Dimension object is used to contain an array length which is named for use in multiple netcdf variables. ... A concrete implementation of the Netcdf interface, this class provides connection to NetCDF version 1 files. ... Interface Netcdf - Extends set of Variable, has a DimensionSet and an AttributeSet. ...

Еще в разделе: (Показать все результаты (>214) - angel.cs.msu.su/ )

• Generated Documentation (Untitled)
• Index
• : Package ucar.multiarray

... Главная -> Фильмы -> The Doom Generation . ... Фильмы . ... The Doom Generation . ... США - Франция 1995 . ... Gregg Araki . ... Cevin Key . ... Margaret Cho . ... Amanda Bearse . ...

Еще в разделе: (Показать все результаты (>113) - kinfo.ru/ )

• Evil Dead: Regeneration - Фильмы - Kinfo.ru
• Generation Kill - Фильмы - Kinfo.ru
• The Guilty Generation - Фильмы - Kinfo.ru

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>20) - tukachev.flogiston.ru/ )

• Category: Новости

... Like ordinary make, metamake keeps platform-dependent files (object, executables, libraries) for repeated usage. To use the metamake, one must define basic project directories (task directory, target root, object directory etc) and prepare two simple files: task-file that contains common project settings (selected compilers, common system libraries etc) and architecture- independent Imake-file which includes project description along with compiler and linker directives. ...

Еще в разделе: (Показать все результаты (>60) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/ivanchenko/iv.pdf
• http://acat02.sinp.msu.ru/presentations/kodolova/acat.pdf
• http://acat02.sinp.msu.ru/presentations/brun/Exercises_2.doc

Russian TeX Disk . ... Please, use "Save link as" (right mouse button) for downloading files, otherwise binary files will be corrupted. What is russian TeX disk . ... Some TeX versions and tools are installed/russified and can be started directly from CD; other are only distributives plus additional files for their russification. ... FPTEX . ... Directory russian.add: Generic files (mf-sources, pfb-fonts and hyphen file) for russification of any-TeX-realizations in: . ... file readme: . ...

Еще в разделе: (Показать все результаты (>5) - tex.bog.msu.ru/ )

• http://tex.bog.msu.ru/rustexeo.html

... Recommended values . Start word length . Start length of motiff for Multiple sequence alignment. ... Max N Mismatches . ... Min score . ... Gap parameter . This parameter defines gap scoring. the grater this value is the stronger gap will be panalysed . ... If inforation content of a column is less than given value the column should be not included into alignment. the grater this value is the stronger gap will be panalysed . ... Max loop . Max energy of a helix . ... cgcatagctc cacca . ...

Еще в разделе: (Показать все результаты (>140) - bioinf.fbb.msu.ru/ )

• SDPsite - Algorithm Format requirements
• SDPsite - Gallery of examples
• Alignment example