fitshdr_edit - FITS-file headers interactive editor fitshdr_edit [options] FITSfile_name . fitshdr_edit utility allows to modify FITS headers' lines interactively (FITS MultiExtentionsFiles included). fitshdr_edit is just simple shell script around fitshdr utility. ... It means, that You can't remove line from header! ... 560:CRDELT2 = 21.0 / this is example 640: 720:HISTORY header No.0: 1st history line 123456789012345678901234567 880:COMMENT Sat Sep 25 21:17:34 CEST 2004 / by fitshdr_edit . ...

Еще в разделе: (Показать все результаты (>163) - lnfm1.sai.msu.ru/ )

• Manpage of FITSHDR
• Description of Data
• HSFA 2 technical description Technical Details

... Data . ... Services . ... Solar energetic particles . ... N -d SW Conditions : Time profiles of the key geomagnetic ( Ap and Dst indices), solar wind (velocity V , density n and temperature T ) and IMF ( B , Bx , By , Bz in GSM) parameters observed in the N day vicinity of the geomagnetic disturbed day. N -d Map of Solar Events : Map of solar surface events occurred within N day vicinity of the moment when the solar wind expansion (which causes the geomagnetic event) started. ... WIND . ...

Еще в разделе: (Показать все результаты (>15) - smdc.sinp.msu.ru/ )

The Trac Roadmap = [[TracGuideToc]] The roadmap provides a view on the [wiki:TracTickets ticket system] that helps planning and managing the future development of a project. ... Note:''' Milestone descriptions can not currently be edited using 'trac-admin'. == iCalendar Support == The Roadmap supports the [http://www.ietf.org/rfc/rfc2445.txt iCalendar] format to keep track of planned milestones and related tickets from your favorite calendar software. ...

Еще в разделе: (Показать все результаты (>2859) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.su/trac/tanchiki/wiki/TracRoadmap?version=1&format=txt
• TracRoadmap (diff) тАУ Tanchiki
• Help: hgignore

Protein 3D architectures and structural motifs: automated annotation E.A. Aksianov1, A.V. Alexeevski 1 2 1,2 Belozersky Institute, Lomonosov Moscow State University, Leninskie Gori 1, Moscow, Russia Scientific Research Institute for System Studies (NIISI RAN), Moscow, Russia evaksianov@gmail.com, aba@belozersky.msu.ru Description of a protein 3D structure in terms of structural domains, architecture, topology and structural motifs is a hard problem. ... The core is extended by small -sheet (unit_3). ...

Еще в разделе: (Показать все результаты (>81) - mccmb.belozersky.msu.ru/ )

... About lab . ... Roadway video passport systems are widely-used for detailed road mapping which allows roadway quality monitoring and repair planning. ... Typical roadway images are strongly differed to each other in colors and texture, some examples are shown below. Typical source images for roadway analisys . ... We use so-called rectified images of the road covering. ... When preprocessing is completed our algorithm is trained on a part of rectified road image with the help of user input. ...

Еще в разделе: (Показать все результаты (>175) - graphics.cs.msu.ru/ )

• Road monitoring | Лаборатория компьютерной графики и мультимедиа
• Removal of noise from video | Graphics and Media Lab
• Removal of noise from video | Лаборатория компьютерной графики и мультимедиа

... Structure of Data . ... Catalog . ... The SAI OCL Catalog site provides several VO-enabled modes of operation: . VO-enabled catalog data analysis from a browser . ... Endpoint URL is http://ocl.sai.msu.ru/catalog/conesearch/ . ... VO-enabled catalog analysis from a browser . Presently, this recipe works with Firefox (Windows, MacOS, Linux), Internet Explorer (Windows) and Opera (Windows) browsers with Java plugin 1.6 installed. ... Main TOPCAT window with SAI OCL catalog loaded will appear. ...

Еще в разделе: (Показать все результаты (>222) - ocl.sai.msu.ru/ )

• SAI OCL Catalog Description

. Nhunt: program for nucleic acid sequence similarity search . Download . User manual . Application examples . License . News . About . Authors publications . Contacts . Web interface . At present you can download poster from MCCMB'11 conference and my term work (in Russian) with description of main program algorithms. Funding: Ministry of Education and Science of the Russian Federation (State Contract No. 07.514.11.4006). Copyright 2010-2011 Yury Pekov

Еще в разделе: (Показать все результаты (>15) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes

Asymptotic behavior of form factor of the composite system at large momentum transfer. ... Comparison of predictions CQM and pQCD for the pion in the Instant form of relativistic quantum mechanics The electromagnetic current matrix element for pion: p | ... Asymptotic behavior of the pion form factor for Q 2 · Pointlike quarks: d d u u GE (Q 2 ) + GE (Q 2 ) = 1, GM (Q 2 ) + GM (Q 2 ) = 1 Ї Ї F (Q 2 ) quarks: 25/2 M - e Q QM 4b 2 1+ 7b2 2MQ . ...

Еще в разделе: (Показать все результаты (>116) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks/QFTHEP2011.pdf
• http://qfthep.sinp.msu.ru/talks/kinks1.pdf
• http://qfthep.sinp.msu.ru/talks/kinks.pdf

... It is shown that theoretical methods developed for description of hopping transport in disordered inorganic solids, such as amorphous semiconductors, can also be successfully applied to description of hopping transport in organic disordered systems, such as conjugated or molecularly doped polymers. We concentrate our discussion on percolation approach and show its universal applicability to systems with different distributions of localized state energies. ...

Еще в разделе: (Показать все результаты (>38) - scon155.phys.msu.su/ )

• Generalized pair approximation in the description of ate AC conductivity of a

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>12) - antares.sinp.msu.ru/ )

... Linguistic expeditions . ... Logical and stylistic aspects of lexical semantics . ... Linguistic phenomena can be approached and described from various perspectives. ... The approach proposed here is distinctive in that it is based on logic and stylistics, which are usually considered marginal to the description of linguistic phenomena. ... A special focus in the present approach on parallel texts is directly connected with translation . ...

Еще в разделе: (Показать все результаты (>17) - lcl.srcc.msu.ru/ )

Application of the Quickhull algorithm's principles to the double description method" . Bastrakov S.I., Zolotykh N.Yu. The double description method known also as the Motzkin-Burger algorithm is a method for computing the general solution of a system of linear inequalities. ... The numerical results demonstrate a number of advantages of the proposed modification over the original double description method and (in many cases) over the Quickhull algorithm. ... PostScript (in Russian) (1.51MB) . ...

Еще в разделе: (Показать все результаты (>134) - num-meth.srcc.msu.ru/ )

• "TreeDL: a language for description of graph structures and operations on them"
• "Automatic detection and description of supercomputer network infrastructure"
• "Implementation of the Lagrangian approach to the description of gas-particle

... 2013-03-19 02:34 . ... index.htm . ... 1.1M . ...

Еще в разделе: (Показать все результаты (>358) - herba.msu.ru/ )

• Systema Naturae
• Index of /shipunov/school/biol_154/textbook/pics
• Описание экскурсии на гору Малая Куртяжная.

... Parent Directory - 1-1-GeneralTopology-Conspectus-2009.pdf 26-Aug-2009 19:49 189K 1-1-GeneralTopology-Conspectus-Addendum-5-5-2009.pdf 09-Sep-2009 12:56 131K 1-4-Examples-Addendum.pdf 22-Sep-2009 11:50 89K Alexandrov-168-169.pdf 08-Sep-2009 12:36 225K ControlWorks/ 05-Sep-2009 15:50 - FAQ/ 08-Sep-2009 13:53 - Poincare.pdf 08-Nov-2007 15:29 296K Program-2009.pdf 16-Aug-2009 12:31 89K Test1-2009.pdf 28-Aug-2009 15:42 83K UchPr-2009.htm ...

Еще в разделе: (Показать все результаты (>268) - higeom.math.msu.su/ )

... Documentation and description of the Northern Selkup local dialects: the situation of language shift // Congresus XI Internationalis Fenno-ugristarum Piliscsaba 2010. Pars III. Piliscsaba, 2010. ... 116-117. ...

Еще в разделе: (Показать все результаты (>28) - srcc.msu.ru/ )

• Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales
• Kazakevich, Olga. Endangered Languages Documentation and Description: Should

... DESCRIPTION General Catalog of Variable Stars (GCVS database) . ... Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1990, General Catalogue of Variable Stars, 4rd ed., vol.IV, Nauka, Moscow. Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1992, General Catalogue of Variable Stars, 4rd ed., vol.IV, Bull. ... Kazarovets E.V., Durlevich O.V. Editor-in-Chief Samus N.N., 1998, New Catalogue of Suspected Variable Stars. ...

Еще в разделе: (Показать все результаты (>59) - sai.msu.ru/ )

This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>100) - neptun.sai.msu.ru/ )

• Manual Page: ab - Apache HTTP Server
• Apache module mod_negotiation
• Manual Page: rotatelogs - Apache HTTP Server

... Research programm of the laboratory-chair< . ... Laboratory-chair of Discrete mechanics on a microscopic scale . ... Thus the structures of the physical world are not physical objects but physical processes. ... The primitive entity is called a material point. ... The value of the property “existence” of the material point varies from “the material point does not exist” to “the material point exists” by this process. ... Let call this structure a dynamical graph or a d-graph. ...

Еще в разделе: (Показать все результаты (>327) - chronos.msu.ru/ )

• On the Way to Understanding the Time Phenomenon: the Constructions of Time in

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

SDPpred: a tool for prediction of amino acid residues that determine differences in functional specificity of homologous proteins . ... Amino acid residues that determine differences in protein functional specificity and account for correct recognition of interaction partners, are usually thought to correspond to those positions of a protein multiple alignment, where the distribution of amino acids is closely associated with grouping of proteins by specificity. ... As colored columns of the alignment. ...

Еще в разделе: (Показать все результаты (>255) - monkey.belozersky.msu.ru/ )

• Inquiry information || Parsimony algorithm
• SCOP famyli:
• SCOP famyli: T4 endonuclease V