Friday, December 7th, 2012 . ... No Comments ? Monday, December 3rd, 2012 . Добавлена страничка со списком публикаций сотрудников лаборатории за 2012 год. ... You are currently browsing the Лаборатория лазерной интерферометрии blog archives for December, 2012. ... Публикации за 2010 . Публикации за 2011 . Публикации за 2012 . ... January 2013 . December 2012 . ... January 2012 . ... January 2011 . ... Лаборатория лазерной интерферометрии is proudly powered by WordPress . ...

Еще в разделе: (Показать все результаты (>40) - geo.sai.msu.ru/ )

• December 2010 Лаборатория лазерной интерферометрии
• June 2010 Лаборатория лазерной интерферометрии
• site lightbox Лаборатория лазерной интерферометрии

. [ Войти ] . Главная -> Пользователи -> december . Пользователи . Демо . Деньги . Фильмы . Форум . december . Появление: 06.03.2004 2:57:49 . Последнее созидание: 31.12.2009 . Сообщений: - . Рейтинг: . - - - - .

Еще в разделе: (Показать все результаты (>100) - kinfo.ru/ )

• December Boys - Фильмы - Kinfo.ru
• Come December - Фильмы - Kinfo.ru
• A Warm December - Фильмы - Kinfo.ru

Problem 1. ... To solve the problem, we should express the ratio of rate constants at temperatures T 2 and T 1 using the Arrhenius equation. ... X - CH 3 , Y - COOH. ... 0.084 / 56 = 0.03 mol. ... Cu) = 4.8 / 64 = 0.075 mol; (NaOH) = 100 . ... 0.15 . ... 2NO 2 . ... I 2 ) = 0.0375 + 0.1125 = 0.15 mol, m (I 2 ) = 0.15 . ... Example problems in chemistry for the entrance exams: . Preliminary round . ... Special Program developed for chemistry entrance examinations in Moscow State University. ...

Еще в разделе: (Показать все результаты (>209) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 52, No. 6, P. 443 (2011)
• Client-side Clickable Image Example
• Moscow University Chemistry Bulletin Vol. 48, No. 3, P. 178 (2007)

2009 BASIC IP2 WIN TUTORIAL Basic Principles in Using IP 2 Win Software Alva Kurniawan Hydrogeology World alvathea.wordpress.com BASIC IP2 WIN TUTORIAL Basic Principles in Using IP2 Win Software ALVA KURNIAWAN © HYDROGEOLOGY WORLD 2009 Foreword Nowadays we are entering and living in a digital era where most of our activities are being helped by digital equipment. ... 5 Next click File>New VES point like the picture above. ... 13 Close IP2 Win software by clicking File>Exit. ... 15 Click File>Open. ...

Еще в разделе: (Показать все результаты (>54) - geophys.geol.msu.ru/ )

• TES. Modeling example.
• TES. Field example.
• Azimuthal resistivity survey

. research . research .

Еще в разделе: (Показать все результаты (>77) - mgumus.chem.msu.ru/ )

• Seminar 19 December 2002

... Robert Hermann Brookline, MA (Received November 22, 1999) der to illustrate the obvious progress, one can mention a variety of examples. ... In or- FYI Item "BMS Report on Institutes" As a member of the panel commissioned by the Board on Mathematical Sciences of the National Research Council, I write to correct several inaccuracies in the "For your information" note by Allyn Jackson entitled "BMS Report on Institutes" in the December 1999 issue of the Notices. ...

Еще в разделе: (Показать все результаты (>57) - chaos.phys.msu.ru/ )

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... MSU Graphics & Media Lab (Video Group) . Filter is intended for reconstructing panorama of scene by movie. ... The work of MSU Panorama is based on motion vectors. ... MSU Panorama has two processing modes: . ... Example of panorama for ''stefan'' movie . full size image . One more example of MSU Panorama for two processing modes. Example of panorama for ''bus'' movie . ... video@graphics.cs.msu.ru . ...

Еще в разделе: (Показать все результаты (>185) - graphics.cs.msu.ru/ )

• Building panorama image from video | Лаборатория компьютерной графики и
• Removing of blocking effect from video | Graphics and Media Lab
• Removing of blocking effect from video | Лаборатория компьютерной графики и

Marketing Plan Outline Canada Business Service Centres - CBSCs Last Verified: 2004-11-08 Document No. 4014 Summary A marketing plan is designed to direct company activities towards the satisfaction of customer needs; determine what the customer wants, develop a product/service to meet those needs, get the product/service to the end user and communicate with the customer - at a profit! ... levels, sales volumes? ... What is the consumer acceptance price range for this type of product/service? ...

Еще в разделе: (Показать все результаты (>10) - innovation.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>6) - storage.bioinf.fbb.msu.ru/ )

... Run program . User's guide . Launching program . Input data format . ... Selecting the number of correlated pairs . ... In order to run thr program one needs Java 5.0 environment. ... At the end of computations one will be asked to review the selected number of correlated pairs. ... Note: One may redefine the number of correlated pairs by selecting the 'Edit' -> 'redefine correlated pairs number' menu item. Correlated pairs of positions are presented as a colored matrix, the heatmap. ...

Еще в разделе: (Показать все результаты (>134) - bioinf.fbb.msu.ru/ )

• SDPsite - Gallery of examples
• Alignment example

SDPpred: a tool for prediction of amino acid residues that determine differences in functional specificity of homologous proteins . ... Amino acid residues that determine differences in protein functional specificity and account for correct recognition of interaction partners, are usually thought to correspond to those positions of a protein multiple alignment, where the distribution of amino acids is closely associated with grouping of proteins by specificity. ... As colored columns of the alignment. ...

Еще в разделе: (Показать все результаты (>59) - monkey.belozersky.msu.ru/ )

• SDP home page
• Example of supporting positions
• SCOP famyli:

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>13) - tukachev.flogiston.ru/ )

• Category: Новости

... Software . Laboratory of Mathematical Methods of Image Processing . ... Available options: -sigma - (mandatory) set blur parameter for the input image , range: 1.0 to 20.0 - power - set warping power , range: 0.0 to 5.0, default value is 1.0 -1d - apply one-dimensional algorithm (faster but lower quality) basicedges - detect basic edges - edges good for artifact analysis -scale - set scale parameter, range: 1.0 to 20.0, default value is 4.0 gaussblur - blur input ... warp.png . ...

Еще в разделе: (Показать все результаты (>53) - imaging.cmc.msu.ru/ )

DVM-system of parallel program development . Installation guide . ... 1 DVM-system installation under Windows95/NT . ... Microsoft Visual C++ 5.0 version and later (4.0 version can be used with some restrictions, see below); . ... Now the user should copy all files from directory dvm_sys/user to his own directory with DVM programs. ... In this case (but if DVM-system installation was succesfully verified) the user should keep above files with errors and ask for system programmer support. ...

Еще в разделе: (Показать все результаты (>74) - sp.cs.msu.ru/ )

• DVM-system. Installation guide. Version 3.93
• DVM-system. Installation guide. Version 3.95
• Fabrik - A Visual Programming Environment