The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>51) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 4.

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>12) - tukachev.flogiston.ru/ )

• Category: Новости

... The Eastern Europe: Twenty Years Later . ... Aggeeva I.A. Cultural Contact in the Soviet Canadian Relations in the 1950th - in the Early Sixties Years . Chut L.R. The Problem of a Periodization of the Early Modern History in the Domestic Historiography of a Boundary of the 20 and 21 Centuries . ... Monin S.M. A War and a Society in the XX-th Century . ... The Problem of a Periodization of the Early Modern History in the Domestic Historiography of a Boundary of the 20 and 21 Centuries . ...

Еще в разделе: (Показать все результаты (>71) - hist.msu.ru/ )

• Corporate Social Policy as an Approach to Managing the Workforce: Some Examples

fitshdr - FITS-file headers manipulation tool fitshdr [options] [FITSfile_name] . ... fitshdr [options] --edit FITSfile_name . ... If You want to modify headers of FITSFILE using new FITS-header lines from HEADER file (or from stdin), You have to use this option (You can skip this option, if -H or --header option is used). ... Empty header lines are not displayed (in 'dump' mode only). --line-offsets . ... In 'dump' mode: file offset will be displayed for each header line. --no-line-offsets . ...

Еще в разделе: (Показать все результаты (>114) - lnfm1.sai.msu.ru/ )

• Calibration data

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>18) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

О лаборатории . ... Лаборатория теоретической биофизики . ... The manual to FireFly program clearly explain why and how to use spherical or cartesian functions when working with different basis sets. ... The $D5 group provides further control through the D5, F7, and G9 keywords, which pertain to d, f, and g functions, respectively. ... Quantum chemistry information page ERG Research Group: Лаборатория теоретической биофизики написал (Май 19th, 2015 5:52 пп) . ... 2014 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>31) - erg.biophys.msu.ru/ )

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>134) - bioinf.fbb.msu.ru/ )

• Alignment example
• User's guide

. Name . Last modified . Size . Description . Parent Directory . - . alpha/ . 2007-02-10 22:19 . - . alpha_and_beta/ . 2007-02-10 22:19 . - . beta/ . 2007-02-10 22:19 . - . Apache/2.4.12 (Debian) Server at kodomo.fbb.msu.ru Port 80

Еще в разделе: (Показать все результаты (>8811) - kodomo.fbb.msu.ru/ )

• Help: templating
• snake: 954cc2774637 snakes/example.snake
• cca: a308291203ea .hgtags

Alignment COG1325 . ... It is supported by 29 positions - that's written on the scheme. ... Such are positions number 5 ( leucine opposite isoleucine , valine and methyonine ), 30 ( glutamic acid opposite arginine , glycine and serine ), 51 ( threonine opposite alanine , phenylalanine and serine ), 55 ( phenylalanine opposite leucine , histidine and tyrosine ), 111 ( phenylalanine opposite isoleucine , leucine and valine ), 123 ( valine opposite isoleucine , ...

Еще в разделе: (Показать все результаты (>456) - monkey.belozersky.msu.ru/ )

• SDP home page
• SCOP famyli:
• SCOP famyli: Paired domain

... Give an example of chemical reaction between a salt and an acid leading to the formation of another salt and a base. (1 point) [Solution] . ... Write the reactions of chromium (III) bromide with hydrogen peroxide in acidic and basic media. (2 points) [Solution] . ... In the reactions, specify the structures of all substances. (3 points) [Solution] . ... Three substances A, B, and C were mixed in the amount of three moles each. ... Example problems in chemistry for the entrance exams ( main round ) ....

Еще в разделе: (Показать все результаты (>875) - chem.msu.ru/ )

• Client-side Clickable Image Example
• Moscow University Chemistry Bulletin Vol. 42, No. 2, P. 125 (2001)
• Entrance Examinations - Main Round

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... When detection of the change-points in alpha band power was performed as in the previous subsection, more than one change-point per second was obtained in average. ... The hypothesis of the hierarchy of EEG segmental descriptions (Kaplan 1998) (see subsection 7.3.2) is a theoretical reason for introducing the adjustment of the change-point detection probability. ...

Еще в разделе: (Показать все результаты (>43) - brain.bio.msu.ru/ )

• Nonparametric approaches to the description of EEG piecewise stationary

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>16) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus
• Nhunt

NATO Publishing Unit P.O. Box 17 3300 AA Dordrecht A U T H O R 'S D A T A B A S E E N T R Y S H E E T (to be submitted together with the scientific paper ) REFERENCE: ARW978587 TITLE OF THE NATO MEETING/ NATO ASI SERIES VOLUME : Use of Humic Substances to Remediate Polluted Environments: from Theory to Practice NAME OF THE DIRECTOR: Dr. Norbert ... The total space available for keywords and abstract of your paper is 900 characters (approx. 100 words). ...

Еще в разделе: (Показать все результаты (>137) - mgumus.chem.msu.ru/ )

• http://www.mgumus.chem.msu.ru/ihss-14/docs/abstract_template%5Bihss-14%5D.doc
• http://www.mgumus.chem.msu.ru/publication/2008/2008-nikolaev-development.pdf

Introduction Globus ToolkitTM Developer Tutorial The Globus ProjectTM Argonne National Laboratory USC Information Sciences Institute http://www.globus.org/ Copyright (c) 2002 University of Chicago and The University of Southern California. ... Detailed understanding of component functionality ­ Ability to combine components in useful ways l Provide in-depth discussions of the Globus Toolkit. ... March 25, 2002 Globus ToolkitTM Developer Tutorial: Introduction 7 ...

Еще в разделе: (Показать все результаты (>56) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/GGtut/Dev-02-Basics1.pdf

About SPAW Editor . ... As of final version 1.0 of the control you'll need to rename the file spaw_control.default.config.php in config sub-directory to spaw_control.config.php when installing control for the first time. ... All of the SPAW Editor configuration options are located in the config/spaw_control.config.php file. ... This file will be included in img_library.php (Image library dialog script). $request_uri variable will be set to the URL of the page where SPAW Editor instance resides. ...

Еще в разделе: (Показать все результаты (>5) - textbook.sinp.msu.ru/ )

Fortran-DVM . ... Language description . ... 2.2 Syntax of FDVM directives . ... 4.2 Distribution of dynamic arrays . ... 6 Remote data specification . ... 6.2 SHADOW type references . ... 6.2.2 Synchronous specification of independent references of SHADOW type for single loop . ... 6.2.5 Asynchronous specification of independent references of SHADOW type . ... 6.3.3 Asynchronous specification of REMOTE type references . ... 6.4.2 Asynchronous specification of REDUCTION type references . ...

Еще в разделе: (Показать все результаты (>90) - sp.cs.msu.ru/ )

• C-DVM language description
• Debugging DVM-program. User's guide. Part 2
• HPF DVM. Language specification

... the north face outlet . ... ray ban outlet uk . ... 2016 С Днем Победы! ... win 7 ultimate product key Windows 8 key windows 7 key win 7 key windows 7 pro product key win 7 pro product key windows 7 activation key windows 7 ultimate product key windows 7 ultimate serial key windows 7 key online win 7 ultimate key win 7 serial keys Win 7 ultimate key Win 7 ultimate product key windows 7 key sale win 7 ultimate product Key Windows 7 key ultimate win 7 ultimate ...

Еще в разделе: (Показать все результаты (>46) - elana.sinp.msu.ru/ )

• editor | С Днем Победы!
• michael kors outlet uk which is accessible via the Internet as a Web server.
• michael kors outlet uk adding a managed data center makes the company one of

... The national strategic management system in Russian power industry is far from perfect and is in the process of its formation after a long period of radical reform in the industry. ... This article s goal is to offer a more adaptable conceptual model for national strategic management in a branch of economy (on the example of the electric power industry). ... National strategic management, power industry, conceptual model, level of environmental uncertainty. ... Public Administrarion". ...

Еще в разделе: (Показать все результаты (>517) - ee-journal.spa.msu.ru/ )

... About lab . ... MSU Graphics & Media Lab (Video Group) . The filter is intended for high quality recovering visual quality of video compressed using conventional block-transform-based codecs (for example, video ripped from DVD, VideoCD or after decompressing by H.261, H.263, H.264, DivX, XviD, etc). ... Hard blockiness suppression is applied in case of extremely low bitrate when entirely flat single color blocks are appeared on the frame. ... Decompressed frame . ... Frame after Smart Deblocking . ...

Еще в разделе: (Показать все результаты (>221) - graphics.cs.msu.ru/ )

• Smart removal of blocking effects from video | Лаборатория компьютерной графики
• Hide information in video | Graphics and Media Lab
• Removing of blocking effect from video | Лаборатория компьютерной графики и

... Enter here your expression: Process as chemical reaction (not as a phase composition). ... Preview: . ... Кнопка "Remove redundant tags" удалит избыточные тэги sup и sub. ... In the second textbox will appear HTML-code and after the word "Preview" - chemical formula. You can also edit HTML-code in it's textbox and update Preview by "Update preview" button. Button "Copy" is more comfortable than Ctrl+C. "Remove redundant tags" button will delete redundant sup and sub tags. ... HTML-code . ...

Еще в разделе: (Показать все результаты (>365) - geo.web.ru/ )