Firefly (previously known as the PC GAMESS) is a freely available ab initio and DFT computational chemistry program developed to offer high performance on Intel-compatible x86, AMD64, and EM64T processors. ... At moment, Firefly includes no more than 5% of the legacy code. ... Firefly is freely available for all main PC operating systems: Windows, Linux, and Mac OS X. Firefly supports various Windows versions including Windows 8, Windows 7, Windows Server 2008, Vista, 2003, XP, 2000, NT, and 98/Me. ...

Еще в разделе: (Показать все результаты (>78) - classic.chem.msu.su/ )

This module provides for logging of the documents which reference documents on the server. ... Module Identifier: referer_log_module . ... RefererIgnore . RefererLog . ... Module: mod_log_referer . The RefererIgnore directive adds to the list of strings to ignore in Referer headers. ... The RefererLog directive sets the name of the file to which the server will log the Referer header of incoming requests. ... Security: if a program is used, then it will be run under the user who started httpd. ...

Еще в разделе: (Показать все результаты (>107) - neptun.sai.msu.ru/ )

• Apache module mod_imap
• Apache modules
• Server-Wide Configuration

DVM debugger - contents . Part 1 (1 - 4) . ... Writing to read-only variable is detected. ... Using non-initialized element <elem> . ... Using variable <var> before asynchronous reduction competed . ... The dynamic debugger detects access to a shadow element before asynchronous shadow renew competed . ... It is reported when any non-correspondence of trace or loop description file is detected. ... Different values of reduction operation are detected for current event and in reference trace record. ...

Еще в разделе: (Показать все результаты (>156) - sp.cs.msu.ru/ )

• Дополнительная информация к спецкурсу "Функциональные и логические методы
• Lib-DVM. Preliminary design
• Lib-DVM library. Detailed design. Part 3 (12.16-12.18)

... Choice . Up: Data Types Next: Addresses Previous: Named Constants . MPI functions sometimes use arguments with a choice (or union) data type. Distinct calls to the same routine may pass by reference actual arguments of different types. The mechanism for providing such arguments will differ from language to language. For Fortran, the document uses < type > to represent a choice variable; for C and C++, we use void *. ... MPI-2.0 of July 18, 1997 . ... Центры . ...

Еще в разделе: (Показать все результаты (>416) - www.parallel.ru/ )

• Function Name Cross Reference | PARALLEL.RU - Информационно-аналитический центр
• Communicators | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Organization of this Document | PARALLEL.RU - Информационно-аналитический центр

IPv6. IPv4 (2^32 ), IPv6 (2^128 ). ... IPv6, IPv4. ... IPv4 IPv6, () : 255.255.255.0 (/24) --> /56 255.255.255.128 (/25) --> /57 255.255.255.192 (/26) --> /58 255.255.255.224 (/27) --> /59 255.255.255.240 (/28) --> /60 255.255.255.248 (/29) --> /61 255.255.255.252 (/30) --> /62 , : ip: 93.180.49.62 mask(prefix): 255.255.255.192 gateway: 93.180.49.1 dns: 93.180.48.33 , ip 93.180.49.62, IPv6 --> --> --> --> 2a00:f480:9:313e::1 + 2a00:f480:9:313e::2 + .. 58 2a00:f480:9:3101::1 2a00:f480:9:3021::1 ...

Еще в разделе: (Показать все результаты (>2) - physmedia.phys.msu.ru/ )

• http://physmedia.phys.msu.ru/documents/newip.pdf

. Please use the reference to MASTER DataBase as Lipunov et al., 2010, MASTER Robotic Net, Advances in Astronomy, vol. 2010, pp. 1-7 . - days . MASTER , 2002-2016

Еще в разделе: (Показать все результаты (>3) - apollo.sai.msu.ru/ )

... STEREOGRAPHIC PROJECTION . стереографическая проекция . ... Изображение угловых соотношений линий и плоскосте й с помощью проекции на экваториальную плоскость исх одной сферы ( reference sphere ) одним из двух способов: 1) с сох р анением равных углов (проекция Вульфа), обычно с системой координат, известной как сетка Вульфа, или стереосеть ( stereonet ) ; 2) с сохранением равных площадей (проекция Ламберта) обычно с системой координат, известной как сетка Шмидта ( Schmidt net ) (фиг. ...

Еще в разделе: (Показать все результаты (>1079) - geo.web.ru/ )

• COMAGMAT MODEL

An electronic file with the submitted manuscript should be of the following form. %---------------------------- \def\udk{UDC} \ltitle{Title of the manuscript (in CAPITAL LETTERS)} {Author initials and name(s)} \oabstract{ Abstract of the manuscript } Text of the manuscript \end{document} %-------------------------- . ... Sectioning of a manuscript without the use of standard commands can be done as follows: %------------------------------------------------ \par {\bf Title of the section.} ...

Еще в разделе: (Показать все результаты (>43) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Правила

Backlinks to DataForms in System Web ( Search all webs ) . ... Appendix C: CSS Listing of CSS class names emitted from Foswiki core code and standard extensions. ... NEW - 28 Aug 2011 - 11:49 by ProjectContributor . ... NEW - 03 Aug 2010 - 16:42 by ProjectContributor . ... Statistics for System Web Month: Topic views: Topic saves: File uploads: Most popular topic views: Top contributors for topic save and uploads: ... r1088 - 22 Nov 2013 - 23:01 by AdminUser . Number of topics: 29 . ...

Еще в разделе: (Показать все результаты (>7119) - wiki.cs.msu.ru/ )

• (backlinks in all Webs) DataForms < System < Foswiki
• FileAttachment < System < Foswiki
• InstantEnhancements < System < Foswiki

Backlinks to DataForms in all Webs ( Search System Web only ) . ... Appendix C: CSS Listing of CSS class names emitted from Foswiki core code and standard extensions. ... NEW - 28 Aug 2011 - 11:49 by ProjectContributor . ... NEW - 03 Aug 2010 - 16:42 by ProjectContributor . ... Statistics for System Web Month: Topic views: Topic saves: File uploads: Most popular topic views: Top contributors for topic save and uploads: ... r1088 - 22 Nov 2013 - 23:01 by AdminUser . Number of topics: 29 . ...

Еще в разделе: (Показать все результаты (>9759) - wiki.cmc.msu.ru/ )

• (backlinks in System Web) DataForms < System < Foswiki
• PerlDoc < System < Foswiki
• FileAttachment < System < Foswiki

... Query= sp|P0AAI3|FTSH_ECOLI Cell division protease ftsH OS=Escherichia coli (strain K12) GN=hflB PE=1 SV=1 (644 letters) Database: pm 204 sequences; 2,269,587 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE006080 Pasteurella multocida subsp. multocida str. Pm70 sectio.. ... Pm70 sectio... 48 2e-06 AE006234 Pasteurella multocida subsp. multocida str. ... Pm70 section 47 of 204 of the complete genome. ...

Еще в разделе: (Показать все результаты (>1543) - kodomo.cmm.msu.ru/ )

• page of Dovgan Kirill

... Russian Pages . CDFE: Home Page . ... Numerical data, graphics, and bibliography . ... description] . Last updated: May 6th, 2014 . ... Last updated: June 15th, 2011 . ... Last updated: . ... Last updated: April 4th, 2015 . ... Last updated: February 25th, 2016 . ... Last updated: September 27th, 2011 . ... Photonuclear Data Index since 1955 . ... Last updated: September 15th, 2015 . ... Last updated: March 22th, 2010 . ... Last updated: March 19th, 2015 . ... Last updated: May 15th, 2002 . ...

Еще в разделе: (Показать все результаты (>4917) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Relational ENSDF
• CDFE => Online Services => NSR Search Engine
• CDFE provides the major photonuclear databases. Online Services.

The adaptive correction of wave front in turbulent atmosphere by using a reference source Diploma thesis abstract Student: Kulikov V.A. Scientific adviser: prof. Shmalhausen V.I. The present paper deals with correction of wave front from a slight star based on the measurement of the wave front the reference. ... Minimization of errors of restoration of wave front can be gained by different methods. ... The wave front Zernike coefficients restoration from the slight star was simulated as well. ...

Еще в разделе: (Показать все результаты (>272) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2013/Gavrik_Bruevich_en.pdf

... Data . ... Services . ... Solar energetic particles . ... N -d SW Conditions : Time profiles of the key geomagnetic ( Ap and Dst indices), solar wind (velocity V , density n and temperature T ) and IMF ( B , Bx , By , Bz in GSM) parameters observed in the N day vicinity of the geomagnetic disturbed day. N -d Map of Solar Events : Map of solar surface events occurred within N day vicinity of the moment when the solar wind expansion (which causes the geomagnetic event) started. ... WIND . ...

Еще в разделе: (Показать все результаты (>68) - smdc.sinp.msu.ru/ )

University Satellites and . Space Science Education . General information Date and Location Objectives of the meeting Sponsoring Organizations International Advisory Committee Local Organizing Committee Deadlines Addresses Hotels & Accommodation Venue Visas Social Programme . ... contact Organizing Committee ( universat2006@srd.sinp.msu.ru ) as soon as possible. ... Skobeltsyn Institute of Nuclear Physics, Moscow State University, 2005-2006 . ...

Еще в разделе: (Показать все результаты (>6708) - cosmos.msu.ru/ )

... Development of a candidate secondary reference procedure (immunoassay based measurement procedure of higher metrological order) for cardiac troponin I: I. Antibody characterization and preliminary validation. ... In this study, the first steps in the development of a secondary reference measurement procedure (RMP) 'higher metrological order measurement procedure' to support the cardiac troponin I (cTnI) standardization initiative is described. ...

Еще в разделе: (Показать все результаты (>178) - biochem.bio.msu.ru/ )

... on the project . ... Laws on labour relations . Statistical and reference materials . Publications of the end of 19th - first three decades of 20th centuries . Publications of 1930s-1980s . Publications of the end of 20th - the beginnig of 21th centuries . Papers on the state regulation of labour relations . Bibliography on labour relations . ... Digitised images of archival and other historical documents . Electronic versions of archival and other documents . ...

Еще в разделе: (Показать все результаты (>189) - hist.msu.ru/ )

• Internet-Heuristics for Historians: Course on Web Search and Data Retrieval.
• Справочники по истории в Интернете
• History of Russia. Electronic resources

... References Download PDF . ... Morphometric variation of voles Microtus middendorffii sensu lato and M. gromovi was examined based on 221 skulls. ... The voles of M. gromovi are very similar morphologically to M. middendorffii . ... Clethrionomys Tilesius, 1850 is the valid generic name for red-backed voles and Myodes Pallas, 1811 is a junior synonym of Lemmus Link, 1795 . ... Therefore, Clethrionomys remains the valid genus name for red-backed voles and Myodes is a junior synonym of Lemmus . ...

Еще в разделе: (Показать все результаты (>5726) - zmmu.msu.ru/ )

... Identities = 27/91 (29%), Positives = 44/91 (48%) Frame = +2 Query : 9 RFAPSPSGELHFGSLIAALGSYLQARARQGRWLVRIEDIDPPREVPGAAETILRQLEHYG 68 RF P P+G LH G + ++ A QG +R +D +P +E ++I + +E G Sbjct : 3014 RFPPEPNGYLHIGHAKSICLNFGIAEDYQGLCNLRFDDTNPVKEDVEYVDSIKQDVEWLG 3193 Query : 69 LHWDGDVLWQSQRHDAYREALAWLHEQGLSY 99 W+G+ + S D L E+GL+Y Sbjct : 3194 FKWEGEPRYASDYFDQLYGYAIELIEKGLAY 3286 Database : pm Posted date: Oct 28, 2009 6:14 PM Number of letters in database : 2,269,587 ...

Еще в разделе: (Показать все результаты (>7425) - kodomo.fbb.msu.ru/ )

• http://kodomo.fbb.msu.ru/~element/Term3/blast_3.txt
• http://kodomo.fbb.msu.ru/~element/Term3/pm.txt
• http://kodomo.fbb.msu.ru/~xedin/Term2/Practice3/srs_tables.doc

A hybrid database (information system) on the molecular spectral constants" . Kochikov I.V., Kuramshina G.M., Samkov L.M., Sharapov L.A., Sharapova S.A. A database (information system) on the molecular constants of the crude oil compounds and products of oil refinement is presented. ... A hybrid-type information system includes references and information modules integrated with a numerical package allowing immediate basic processing of molecular spectral data. PostScript (in Russian) (215KB) . ...

Еще в разделе: (Показать все результаты (>306) - num-meth.srcc.msu.ru/ )

• Information for Authors
• Using Intel Xeon Phi coprocessors for execution of natural join on compressed
• "Improving document ranking based on logs of search engine users"