... Of course, you need to have iwconfig installled on your system. ... matching is done on the first 3 bytes of the MAC address # SMC2835W EZ Connect g 2.4GHz 54 Mbps Wireless Cardbus Adapter 00:04:E2:*) INFO = SMC2835W EZ Connect g 2.4GHz 54 Mbps Wireless Cardbus Adapter # ESSID (extended network name) : My Network, any ESSID = any # NWID/Domain (cell identifier) : 89AB, 100, off NWID= # Operation mode : Ad-Hoc, Managed, Master, Repeater, Secondary, auto MODE = Managed # Frequency or ...

Еще в разделе: (Показать все результаты (>21436) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/skel.ebuild
• http://mirror.msu.net/pub/gentoo-portage/dev-util/build/build-0.3.9.ebuild
• http://mirror.msu.net/pub/gentoo-portage/sys-fs/fuse/fuse-2.9.4.ebuild

... Reducing trigonometric expressions . Heuristics for trigonometric expressions . ... If some parameters appear to be the elements of the orthogonal matrix such as quark mixing Cabbibo-Kobayashi-Maskava matrix, one should declare them by the statement OrthMatrix( {{ , , }, { , , }, { , , }} ). where denote the parameters. ... If the substitution for one angle combination is defined, LanHEP offers to define the other ones for expressions consisting of parameters used in previous SetAngle statements. ...

Еще в разделе: (Показать все результаты (>918) - theory.sinp.msu.ru/ )

• Tensor ghost.
• Examples
• fc3:dokuwiki:example [THEP]

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>68) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• Anis. Page2

... Class . ... METHOD . ... ucar.netcdf.NetcdfRemoteProxyImpl . All Implemented Interfaces: . ... public class NetcdfRemoteProxyImpl . ... This class provides implementation of the interface NetcdfRemoteProxy. ... Constructor Detail public NetcdfRemoteProxyImpl ( NetcdfServer svr, java.lang.String key, AbstractNetcdf nc) throws java.rmi.RemoteException . ... a (Remote)Accessor for the Variable. public void release () throws java.rmi.RemoteException . ... release in interface NetcdfRemoteProxy . ...

Еще в разделе: (Показать все результаты (>155) - angel.cs.msu.su/ )

• : Class AbstractNetcdf
• : Class ConcreteIndexMap
• DataTableModel

... Implemented markup fileIO (closes #56) This is done by adding file format 'markup' or 'markup:formatname', where 'formatname' is otherwise known alignment format. ... 1 import base . ... 6 def from_record ( cls , container , record , name = None ): . ... 17 def to_record ( self ): . ... 29 def refresh ( self ): . 30 for number , monomer in enumerate ( self . ... 35 name = 'index' . ... 38 for index , monomer in enumerate ( self . ... index = index . ... 54 for index , column in enumerate ( self . ...

Еще в разделе: (Показать все результаты (>11935) - kodomo.fbb.msu.ru/ )

• allpy: 21cfc7897a8f README.devel
• allpy: allpy/markups.py diff
• allpy: README.devel annotate

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

... No input file or projection information are needed. ... CYLINDRICAL PROJECTIONS : -Jc lon0 / lat0 / scale (Cassini) -Jj lon0 / scale (Miller) -Jm scale ( Mercator - Greenwich and Equator as origin) -Jm lon0 / lat0 / scale ( Mercator - Give meridian and standard parallel) -Joa lon0 / lat0 / azimuth / scale (Oblique Mercator - point and azimuth) -Job lon0 / lat0 / lon1 / lat1 / scale (Oblique Mercator - two points) -Joc Je lon0 / lat0 / scale (Equidistant). ...

Еще в разделе: (Показать все результаты (>303) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~ivan/gmt/man/triangulate.html
• http://xray.sai.msu.ru/~ivan/gmt/man/pshistogram.html
• Tsiolkovskii's Paradox

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>15) - tukachev.flogiston.ru/ )

• Category: Новости

... Accepted input types are: A sequence in FASTA format begins with a single-line description, followed by lines of sequence data. ... Sequences are expected to be represented in the standard IUB/IUPAC amino acid and nucleic acid codes, with these exceptions: lower-case letters are accepted and are mapped into upper-case; a single hyphen or dash can be used to represent a gap of indeterminate length; and in amino acid sequences, U and * are acceptable letters (see below). ...

Еще в разделе: (Показать все результаты (>133) - www.genebee.msu.ru/ )

• GeneBee BLAST 2.2.8 Services Help
• Screening pattern or alignmemt against PROTEIN databank
• RNA secondary structure prediction

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>70) - mouse.belozersky.msu.ru/ )

• Alignment example
• Example of alignment
• PLANdbAffy: probe-level annotation database for Affymetrix expression

... Software . Laboratory of Mathematical Methods of Image Processing . ... Available options: -sigma - (mandatory) set blur parameter for the input image , range: 1.0 to 20.0 - power - set warping power , range: 0.0 to 5.0, default value is 1.0 -1d - apply one-dimensional algorithm (faster but lower quality) basicedges - detect basic edges - edges good for artifact analysis -scale - set scale parameter, range: 1.0 to 20.0, default value is 4.0 gaussblur - blur input ... warp.png . ...

Еще в разделе: (Показать все результаты (>67) - imaging.cmc.msu.ru/ )

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . Институт проблем экологии и эволюции им. А.Н. Северцова РАН . Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: shall year June best example, essence tax . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>3070) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: center China. the example, the
• Экологический Форум - Фундаментальная Экология: on the will example, refine
• Экологический Форум - Фундаментальная Экология: example, IWC such I is States.

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>137) - monkey.belozersky.msu.ru/ )

• Example of supporting positions
• SDPpred
• SCOP famyli:

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>135) - bioinf.fbb.msu.ru/ )

• Alignment example
• SDPsite - Algorithm Format requirements
• User's guide

.

36. Uropatagium venation pattern in bats as diagnostic character (by the example of

37. Corporate Social Policy as an Approach to Managing the Workforce: Some Examples

38. Intelligent Systems :: Research :: :: Articles

39. http://www.socio.msu.ru/vestnik/archive/2013/4/09.pdf

40. http://antares.sinp.msu.ru/docs/acceptance_bamberg2011-1.pdf