... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... Contact person: Dmitriy S. Vatolin (dmitriy@graphics.cs.msu.ru) . MSU Graphics & Media Lab (Video Group) . Filter is intended for reconstructing panorama of scene by movie. ... The work of MSU Panorama is based on motion vectors. ... Example of panorama for ''stefan'' movie . full size image . One more example of MSU Panorama for two processing modes. Example of panorama for ''bus'' movie . ...

Еще в разделе: (Показать все результаты (>201) - graphics.cs.msu.ru/ )

• Building panorama image from video | Лаборатория компьютерной графики и
• Removing of blocking effect from video | Лаборатория компьютерной графики и
• Removing of blocking effect from video | Graphics and Media Lab

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

... The previous example, Chapter 12, "Expanding Colored Squares Example," illustrates how to expand and contract the clipping region of a layer without changing the wrapping width of the layer. This example illustrates how to capture mouse events so that the user can make a layer's wrapping width wider or narrower by dragging the mouse. ... how to capture mouse events for a layer . how to change the wrapping width of a layer by using the load() function . ... Capturing Events for the Layer . ...

Еще в разделе: (Показать все результаты (>1766) - crydee.sai.msu.ru/ )

• A Simple Example With a Single Chirp Component
• Keyword arguments and default arguments
• Style Sheet Example

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>135) - bioinf.fbb.msu.ru/ )

• SDPsite - Gallery of examples
• Alignment example
• User's guide

Fortran-DVM . ... Language description . ... 2.2 Syntax of FDVM directives . ... 4.2 Distribution of dynamic arrays . ... 6 Remote data specification . ... 6.2 SHADOW type references . ... 6.2.2 Synchronous specification of independent references of SHADOW type for single loop . ... 6.2.5 Asynchronous specification of independent references of SHADOW type . ... 6.3.3 Asynchronous specification of REMOTE type references . ... 6.4.2 Asynchronous specification of REDUCTION type references . ...

Еще в разделе: (Показать все результаты (>114) - sp.cs.msu.ru/ )

• C-DVM language description
• Fortran DVM language description. Part 3 (7-12)
• HPF DVM. Language specification

There is a special set of phase space functions which may be used to construct cuts and distributions in the framework of CompHEP. ... Key Character)(momentum set) . A set of momenta is represented as a set of digits. ... For example, C13 means a cosine of the angle between momenta and . The momenta are assigned to particles according to their sequence in the process name. ... energy of the particle set. ... mass of the particle set. ... transverse momentum of the particle set. ...

Еще в разделе: (Показать все результаты (>898) - theory.sinp.msu.ru/ )

• Goldstone ghost.
• Examples
• Example: Summation of diagrams and symbolic integration by means of the Reduce

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>59) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>12) - tukachev.flogiston.ru/ )

• Category: Новости

trend1d - Fit a [weighted] [robust] polynomial [or Fourier] model for y = f(x) to xy[w] data. trend1d -F < xymrw > -N [ f ] n _ model [ r ] [ xy [ w ] file ] [ -C condition _# ] [ -H [ nrec ] ] [ -I [ confidence _ level ] ] [ -V ] [ -W ] [ -: ] [ -bi [ s ][ n ] ] [ -bo [ s ] ] trend1d reads x,y [and w] values from the first two [three] columns on standard input [or xy [ w ] file ] and fits a regression model y = f(x) + e by [weighted] least squares. ... E.g., a robust quadratic model is -N 3 r . ...

Еще в разделе: (Показать все результаты (>350) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~ivan/gmt/man/spectrum1d.html
• http://xray.sai.msu.ru/~ivan/gmt/man/blockmode.html
• http://xray.sai.msu.ru/~ivan/gmt/man/blockmedian.html

... defmacro defprinter ( name args &body body ) . ... body ) ) . ... defprinter :property ( type name &rest body ) . print-statement-with-body stream body nil "public ~a ~a" type name ) ) . ... defprinter :get ( &rest body ) . print-statement-with-body stream body nil "get" ) ) . ... defprinter :constructor ( name args &rest body ) . ... defprinter :class ( name &rest body ) . print-statement-with-body stream body t "public class ~a" name ) ) . ... defprinter :namespace ( name &rest body ) . ...

Еще в разделе: (Показать все результаты (>2) - depni.sinp.msu.ru/ )

... Software . Laboratory of Mathematical Methods of Image Processing . ... Available options: -sigma - (mandatory) set blur parameter for the input image , range: 1.0 to 20.0 - power - set warping power , range: 0.0 to 5.0, default value is 1.0 -1d - apply one-dimensional algorithm (faster but lower quality) basicedges - detect basic edges - edges good for artifact analysis -scale - set scale parameter, range: 1.0 to 20.0, default value is 4.0 gaussblur - blur input ... warp.png . ...

Еще в разделе: (Показать все результаты (>85) - imaging.cmc.msu.ru/ )

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>17) - mouse.belozersky.msu.ru/ )

• Alignment example
• Example of alignment
• PLANdbAffy: probe-level annotation database for Affymetrix expression

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . Институт проблем экологии и эволюции им. А.Н. Северцова РАН . Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: shall year June best example, essence tax . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>2521) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: on the will example, refine
• Экологический Форум - Фундаментальная Экология: example, IWC such I is States.
• Экологический Форум - Фундаментальная Экология: center China. the example, the

Basic MUSCLE 3.6 . ... Alignment title . ... Output format . CLW CLWSTRICT FASTA MSF PHYI PHYS HTML . Output order . ... Tree Picture Options . Picture formats . None Slanted Slanted 2 Rectangular Rectangular 2 Phylogram Unrooted Unrooted 2 . ... Enter / paste here your sequences in FASTA format ( /gi, '\n').replace(/ \s?t;/gi, '>');">paste example ) . ... Alignment example: . ...

Еще в разделе: (Показать все результаты (>138) - www.genebee.msu.ru/ )

• IGLA-3D User Guide
• RNA secondary structure prediction
• Screening pattern or alignmemt against PROTEIN databank

... Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>103) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika N 5/2010

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>540) - monkey.belozersky.msu.ru/ )

• Example of supporting positions
• SCOP famyli:
• SDPpred

To install package: 1. tar xozvf fitshdr- >.tar.gz 2. cd fitshdr- >/ 3. cd fitshdr 4./config 5. make 6. make install . As result, binaries, scripts and man-pages will be installed. Default location for executables: /usr/local/bin, for man-pages: /usr/local/man/man1 . To change default locations You have to use --prefix, --bindir options for ./config. For example, to install binaries in ${HOME}/bin, man documentations in ${HOME}/man: ./config --prefix=${HOME} . ...

Еще в разделе: (Показать все результаты (>123) - lnfm1.sai.msu.ru/ )

• Data bases of Natural Satellites. Documentation. Sources
• Data bases of Natural Satellites. Documentation. Structure
• Manpage of FITSHDR

Myotis . Uropatagium venation pattern in bats as diagnostic character (by the example of genus Myotis ) . ... By the example of genus Myotis it was shown that venation pattern on uropatagium of bats in some cases can be used as diagnostic character. Venation features on uropatagium allow easy to separate Daubentonв?Ts bat, eastern water bat, big-footed bat, and pond bat from Brandtв?Ts bat, Siberian bat, whiskered bat, and Ikonnikovв?Ts bat. ... Bats]. ... Bats of the Russian Far East]. ...

Еще в разделе: (Показать все результаты (>497) - zmmu.msu.ru/ )

... Corporate Social Policy as an Approach to Managing the Workforce: Some Examples from U. S. History, . ... Corporate social policy is one of the most significant subjects studied by business historians. To attract workers and maintain sound businesses some Russian entrepreneurs adopted paternalistic social welfare policies, described in several recently published works. ...

Еще в разделе: (Показать все результаты (>74) - hist.msu.ru/ )

... Data . ... Models . ... Paraboloid model . ... SHIELDOSE is a model for space-shielding radiation dose calculations. ... Next the index of the detector type is specified, for example '1'. ... The next number indicates the nuclear interaction account, for example 1: . ... The next pair of numbers is about solar protons, the min and max energy of solar protons spectrum, default values are 0.1 and 10000 MeV. ... The next number is the number of spectrum points which divides spectrum for integration. ...

Еще в разделе: (Показать все результаты (>16) - smdc.sinp.msu.ru/ )

• Space monitoring data center
• COSRAD model - Space monitoring data center
• IGRF10 model - Space monitoring data center