Analysis of mutational landscape of patients with chronic lymphocytic leukemia 1 A.V. Terskikh1, A.A. Samsonova2, A.A. Kanapin 2 -Peter the Great St.Petersburg Polytechnic University, St. Petersburg, Russia, anastasiyaterskih@mail.ru; 2-Department of Oncology, University of Oxford, Oxford, UK, a.kanapin@gmail.com, a.a.samsonova@gmail.com A precise understanding of the genomic features of chronic lymphocytic leukemia (CLL) may benefit the study of the disease's staging and treatment. ...

Еще в разделе: (Показать все результаты (>184) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/16.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/88.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/8.pdf

... 2015 . ... Ph.D., Lecturer, Faculty of Philosophy, Lomonosov Moscow State University; Assistant Professor, Sholokhov Moscow State Humanitarian University, Moscow, Russian Federation. ... In this article we analyze the experience of crisis communications in the United States after the terrorist attacks of September 11, 2001 and in the UK after the terrorist attacks of July 7, 2005, including the apparent weaknesses in government statements, as well as public reaction to those statements. ...

Еще в разделе: (Показать все результаты (>105) - ee-journal.spa.msu.ru/ )

OLEA EUROPAEA (OLIVE) OLIVE TAXONOMY Kingdom: plantae Order: lamiales Family: Oleaceae Genus: Olea Species: O. Europaea MORPHOLOGY Root System: great root system allows tree to grow in dry climates could grow from 15cm to 6 meters depending on the climate and type of soil Trunk: younger trees have smooth gray/green bark. ... HARVESTING Harvesting for Oil Step 1 Harvest as soon as the fruit reaches maximum size. ... Tree shakers and mechanical rakes can also be used when harvesting olives for oil. ...

Еще в разделе: (Показать все результаты (>224) - herba.msu.ru/ )

• INTERNATIONAL SYMPOSIUM
• Moscow album
• Systema Naturae

SDPpred: a tool for prediction of amino acid residues that determine differences in functional specificity of homologous proteins . ... Amino acid residues that determine differences in protein functional specificity and account for correct recognition of interaction partners, are usually thought to correspond to those positions of a protein multiple alignment, where the distribution of amino acids is closely associated with grouping of proteins by specificity. ... As colored columns of the alignment. ...

Еще в разделе: (Показать все результаты (>124) - monkey.belozersky.msu.ru/ )

• Example of supporting positions
• SDP home page
• SCOP famyli:

... Software . Laboratory of Mathematical Methods of Image Processing . ... Available options: -sigma - (mandatory) set blur parameter for the input image , range: 1.0 to 20.0 - power - set warping power , range: 0.0 to 5.0, default value is 1.0 -1d - apply one-dimensional algorithm (faster but lower quality) basicedges - detect basic edges - edges good for artifact analysis -scale - set scale parameter, range: 1.0 to 20.0, default value is 4.0 gaussblur - blur input ... warp.png . ...

Еще в разделе: (Показать все результаты (>106) - imaging.cmc.msu.ru/ )

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>16) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

Search: . ... About Trac . ... Previous Revision . Latest Revision . Next Revision . ... Revision Log . View revision: . ... Revision 57:2f62804e21fc , 517 bytes checked in by Daniil Alexeyevsky <me.dendik@тАж>, 5 years ago ( diff ) . Added example snake . ... snake Example . ... Rule 1: chase enemy tail . ... Rule 2: stick to walls . ... Powered by Trac 0.12.5 . ... Visit the Trac open source project at . http://trac.edgewall.org/ ...

Еще в разделе: (Показать все результаты (>1418) - kodomo.cmm.msu.ru/ )

• TracSyntaxColoring тАУ Tanchiki
• examples.zip тАУ Cyclyc Cell Automata
• WikiRestructuredText тАУ Tanchiki

Diploma thesis abstract " Comparison of vibrational spectra of white oil paints of the XX century artwork " In the world of painting the problem of preservation of works of art in their original form , as well as their restoration and repainting is particularly acute. ... The methodology for determining the time of writing of the painting based on spectroscopic data is being developed. The question of interaction of pigments in the paint is debated. ...

Еще в разделе: (Показать все результаты (>44) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2008/Dolgovsky_Chikishev_en.pdf

... A layered optical material can modulate electric field amplitude and phase of a femtosecond pulse in space and time. ... In this work femtosecond dynamics of Faraday rotation is demonstrated experimentally in magnetophotonic microcavities (MMC) and thin magnetic films. ... 1 Faraday rotation time dependences in (a) and thin magnetic film (b). The Faraday rotation in MMC growth is much faster than in thin film due to high Q-factor of the structure. ...

Еще в разделе: (Показать все результаты (>45) - nanolab.phys.msu.ru/ )

• http://nanolab.phys.msu.ru/sites/default/files/mism2014.doc

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>133) - bioinf.fbb.msu.ru/ )

• Alignment example
• User's guide

... Рассказ о факультете . ... Ученый совет . ... Символика факультета . Новости факультета . Вакансии факультета . ... Программы подготовки на факультете . ... Полезные ссылки . ... Факультет иностранных языков и регионоведения МГУ имени М.В. Ломоносова искренне поздравляет Илону Мезенцеву и желает ей творческих успехов! ... Факультет иностранных языков и регионоведения МГУ имени М.В. Ломоносова . ... 2000 - 2016 Факультет иностранных языков и регионоведения МГУ имени М.В. Ломоносова . ...

Еще в разделе: (Показать все результаты (>73) - ffl.msu.ru/ )

... Рус. ключевые слова: безопасность жизнедеятельности, водная среда, математические модели, устойчивое развитие, экологический менеджмент, Астраханская обл. посмотреть реферат . ... Рус. ключевые слова: водная среда, экосистемы . ... Mass balance modeling of priority toxic chemicals within the Great Lakes: RateCon model results / Booty W. G., Resler O., McCrimmon C. // The 45 Conference on Great Lakes Research, Winnipeg, June 2-6, 2002. ... June 10-14, 2001 . ... Great Lakes Res. ... 2001, -С. 115-116...

Еще в разделе: (Показать все результаты (>31) - ecoinformatica.srcc.msu.ru/ )

• http://ecoinformatica.srcc.msu.ru/print_html.php?keyword=&num_records=1&theme=6&subtheme=29&from=&ref_ind=0408001306
• http://ecoinformatica.srcc.msu.ru/print_html.php?keyword=&num_records=1&theme=6&subtheme=29&from=&ref_ind=0207000043
• http://ecoinformatica.srcc.msu.ru/print_html.php?keyword=&num_records=1&theme=6&subtheme=29&from=&ref_ind=0207000044

... Home > Scientific laboratories > IM . ... The Laboratory of Industrial Mathematics (LIM) headed by Professor V.M. Goloviznin was established in the Faculty of Computational Mathematics and Cybernetics (CMC) of Lomonosov Moscow State University in 2011. ... In the area of energy and space, examples of topical engineering problems LIM is involved in, include the numerical simulation of new-generation atomic plants and computational aeroacoustics. ... Source URL: http://en.cs.msu.ru/laboratories/im . ...

Еще в разделе: (Показать все результаты (>84) - en.cs.msu.ru/ )

• Laboratory of Industrial Mathematics | CMC MSU
• CMC MSU
• About the faculty | CMC MSU

University Satellites and . Space Science Education . ... News . ... Internet seminars as the new way of Inter-University Aerospace Centre activity . ... In such a dynamic field as remote sensing, the Internet resources already beat traditional libraries and image depositories. ... In 2000-2005 seven Internet-based seminars were held: "Obtaining satellite images over Internet". ... Images of new types. ... Skobeltsyn Institute of Nuclear Physics, Moscow State University, 2005-2006 . ...

Еще в разделе: (Показать все результаты (>165) - cosmos.msu.ru/ )

• UNIVERSAT-2009: University Satellites in Space Sciences Education, Zvenigorod,

... H. Purcell: Ode for Queen Mary . Г. Перселл: Ода на день рождения королевы Марии . Henry Purcell . ... Ode for Queen Mary (1692) . Ода на день рождения королевы Марии (1692) . ... Verse and ritornello Love's goddess sure was blind this day . ... Строфа и ритурнель Любви богиня поистине слепа была в сей день, . ... Verse Those eyes, that form, that lofty mien, . ... Строфа и ритурнель Пусть пример ее благой изгонит прочь . ... Строфа и ритурнель Пусть много дней таких она еще узрит, . ...

Еще в разделе: (Показать все результаты (>19) - music.genebee.msu.ru/ )

... education . research . ... This talk will focus on one of the emerging technology for solar light conversion into electricity; the dye-sensitized solar cell. ... The present lecture will give a general background to the solar energy field with a focus on dye-sensitized solar cells. ... С докладом Dye-sensitized Solar Cells Materials and Interfaces выступил профессор Lars Kloo из Королевского технологического института г. Стокгольма. ...

Еще в разделе: (Показать все результаты (>8) - nano.msu.ru/ )

... CC Large Hall, Chair G. Passarino . ... Parallel Session, 15:00 - 18:30 . ... A. Vaniachine, Data challenges in ATLAS (ID=524) 30 min . ... 15:00 - 16:20 (each talk of 20 min), Chair G. Ososkov . L. Litinskii, Optical Neural Network Based on the Parametrical Four-Wave Mixing Process (ID=233) . ... G. Ososkov, Effective Training Algorithms for RBF-Neural Networks. ... Orlov, Neural Network Approach to Discovering Temporal Correlations (ID=292) Parallel Session, 15:00 - 18:10, 25 June . ...

Еще в разделе: (Показать все результаты (>54) - acat02.sinp.msu.ru/ )

Series on Stability, Vibration and Control of Systems, Series A - Vol. ... After a basic introduction into the stability theory for linear autonomous systems it closely investigates the behaviour of simple and multiple eigenvalues of linear systems. ... This book is highly recommended for researchers involved in the stability investigation of physical systems, because it explains the theory from the basic facts up to a sophisticated level. Reviewed by Professor Alois Steindl . ...

Еще в разделе: (Показать все результаты (>29) - mailybaev.imec.msu.ru/ )

GMATCH . That projects is aimed for the solution of the well known problem of all observational astronomers -- the WCS alignement of the images. It is always great to have the possibility to determine the exact J2000 coordinates of each point of the frame. It is always great to not manually align the images before summing them. My program is aimed to solve all those problems. ... Download . ... WCSLIB library (by M. Calabretta)(download from here ) . ...

Еще в разделе: (Показать все результаты (>137) - lnfm1.sai.msu.ru/ )

• Trip over old Shanghai
• Manpage of FITSHDR
• Calibration data

К О М П А С - III . ... Great Britain '91 Census data: Greater Manchester . Data of project "Spatial Mining for Data of Public Interest SPIN!" ... Отчет об исполнении консолидированного бюджета субъектами РФ на 1.01.2002. ... Распределение средств федеральных фондов, дотаций, субвенций и субсидий на 2002 год. Данные Федерального Закона "О федеральном бюджете на 2002 год" . ... Данные Приложения 27 к Федеральному Закону "О федеральном бюджете на 2002 год" . ... Данные ГОСКОМСТАТ" . ...

Еще в разделе: (Показать все результаты (>332) - geo.web.ru/ )

• Untitled Document
• МЕСТОНАХОЖДЕНИЯ МИНЕРАЛОВ
• Все о геологии :: ChemEl 1.0