... Next: Temperature calibration file format Up: Scanning Probe Microscopy Image Previous: Format of Legend Contents Index . To install the software launch the program setup.exe, which is present at the installation disk. ... In case you install server part of the software (if you choose Server software, Full or Custom options during software installation), you need: 1. ... You should log on to your computer as administrator or as a user with administrator rights. ...

Еще в разделе: (Показать все результаты (>99) - www.spm.genebee.msu.ru/ )

• Temperature calibration file format
• Software structure
• Scanning Probe Microscopy Image Processing Software User's Manual FemtoScan

... X-COM: Distributed Computing Software . ... The idea of distributed computing, or metacomputing, is to combine available computational resources for different applications processing. ... For these applications we simultaneously used high-performance computational resources of Moscow State University and Russian Academy of Sciences, computing centers of Saint Petersburg, Novosibirsk, Chelyabinsk, Ufa, Tomsk, etc. ... Research Computing Center (RCC) of Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>70) - hpc.msu.ru/ )

• HOPSA - the joint RF/EU project: HOlistic Performance System Analysis | Moscow
• Octoshell: Lightweight and Innovative Cluster Management System | Moscow

This diagram illustrates the effects of absolutely positioning a box. A document window is shown, with 8 lines (numbered 1 to 8), each 24px high. All text outside the "outer" box has been flowed into lines 1 and 2. The "outer" box is positioned absolutely so that it occupies the lower right quadrant of the document window. ... The lines, as they appear in the image, contain: 1 Beginning of body contents. End of 2 body contents. ... Inner 7 contents. End of 8 outer contents. ...

Еще в разделе: (Показать все результаты (>2930) - crydee.sai.msu.ru/ )

• Dynamic HTML in Communicator
• Long description for change bar example
• A Simple Example With a Single Chirp Component

... For those who is interested in thermodynamic modeling . Yuri Shvarov . This page is aimed mainly at the users of the software package HCh for thermodynamic (equilibrium) modeling of (geo)chemical systems and processes. However, some files presented here may also be of some interest to those who do not use HCh. ... HCh for DOS . ... User's guide for the Unitherm program intended for maintaining thermodynamic databases and calculation of thermodynamic properties of substances . ...

Еще в разделе: (Показать все результаты (>51) - www.geol.msu.ru/ )

• Software for resistivity and induced polarization

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Рейтинг: 3392 . Post deleted by Administrator [ re: Midget ] . ... Post deleted by Administrator . ... Рейтинг: 9841 . ... Post deleted by Administrator [ re: delfa ] . ...

Еще в разделе: (Показать все результаты (>5836) - www.fds-net.ru/ )

... Магистерское образование . Второе высшее образование . ... This is an obligatory course for 1-year students, studying for the magisterial degree ?Open Information systems? and ?Network software?. ... Are researched the most frequently used applied protocols of net security and protocol of creating virtual private nets. ... This is an obligatory course for 1-year students, studying for the magisterial degree ?Program devices of net?. ... Магистратура: master@cmc.msu.ru, 3-й этаж, комната 360, тел. ...

Еще в разделе: (Показать все результаты (>23) - hcs.cmc.msu.ru/ )

• Master program "Software for Computer Networks" | Магистерское и послевузовское
• Master program "Information Security and Cryptography" | Магистерское и

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Chimgan . ... Post deleted by Administrator . ... Post deleted by Administrator [ re: Yer_sub ] . ... Post deleted by Administrator [ re: Chimgan ] . ...

Еще в разделе: (Показать все результаты (>3659) - www.snto-msu.net/ )

. Пользователям: . Авторизация . Регистрация . Аксиома это истина, на которую не хватило доказательств. Форумы > Первокурсникам > Профайл пользователя . Форумы Список тем . Administrator [ Найти все посты ] . Посты: . 355 . Дата регистрации: . 28.07.2002 12:29 . Последний визит: . 22.02.2012 12:40 . Сайт работает с 29.08.2000, Copyright 2000 2011 MMOnline.Ru and MMForce.Net, . Правовая информация Свяжитесь с нами Участие в проекте Разместить рекламу .

Еще в разделе: (Показать все результаты (>744) - www.mmonline.ru/ )

• MMOnline | Форумы | Обсуждение сайта | почта не работает!
• MMOnline | Форумы | Обсуждение сайта

... Take latest Pacman and install it : Create somewhere directory software/ and simply untar Pacman there : cd software wget http://physics.bu.edu/pacman/sample_cache/tarballs/pacman-latest.tar.gz tar xzf pacman-latest.tar.gz # It will be created, for example, directory pacman-3.21/ rm -f pacman-latest.tar.gz ln -s pacman-* pacman cd pacman source setup.csh # or setup.sh cd .. ... For instance, if you do pacman -allow tar-overwrite this setting remains as a default until you change it. ...

Еще в разделе: (Показать все результаты (>12) - lhe.sinp.msu.ru/ )

... License . ... This program is free software: you can redistribute it and/or modify . it under the terms of the GNU General Public License as published by . the Free Software Foundation, either version 3 of the License, or . ... This program is distributed in the hope that it will be useful, . ... GNU General Public License GNU General Public License for more details. ...

Еще в разделе: (Показать все результаты (>16) - mouse.genebee.msu.ru/ )

• ConClus
• Align tool for DNA-protein complexes

Previous article . Next article . ... The ChromatoMod Program for the Retention Simulation in the Reversed-Phased Ion Pair HPLC . Abstract The software “ChromatoMod” for treatment of chromatographic data and modeling retention in the ion pair reversed-phased HPLC was developed. ... Moscow University Chemistry Bulletin . 2004, Vol. ... Copyright (C) Chemistry Dept., Moscow State University, 2002 . ... Copyright (C) Chemisty Department of Moscow State University . ...

Еще в разделе: (Показать все результаты (>338) - chem.msu.ru/ )

• Client-side Clickable Image Example
• Chromatogram generator: chromatogram modelling software
• Entrance Examinations - Preliminary Round

Alignment DNA issues are still actual in modern genetics. Known algorithms (for example, heuristic algorithm used by BLAST software, Needleman­Wunsch algorithm) are provide solution, but possible are not completely optimal by speed, computational resources or don't provide fullness search (needed accuracy) for solution finding. ... In this paper a method that can ensure absolute accuracy, is presented. ... Known methods of alignments are discussed and demonstrated. ...

Еще в разделе: (Показать все результаты (>181) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/95.pdf

Prediction of physical properties of materials based only on their chemical composition has long been an intriguing task. ... The main interests of Prof. Lebedev 's group are physical properties of crystals exhibiting structural instability, in which different phase transitions (including the ferroelectric one) can appear. ... A.I. Lebedev. ... Physics of the Solid State 51 , 362 (2009) ; e-print arXiv:1305.0240 (2013) ; [local copy] . ... Physics of the Solid State 51 , 2324 (2009) ; [local copy] . ...

Еще в разделе: (Показать все результаты (>52) - scon155.phys.msu.su/ )

... When done, clean out directory with "make clean". ... NETCDFLIB = $(NETCDF)/ lib NETCDFINC = $(NETCDF)/include SHELL=/bin/sh MAKE _OPTS = RANLIB=$(RANLIB) CFLAGS = -I$(NETCDFINC) $(SI) $(CC_OPT) $(TRIANGLE_D) -fPIC CDF = -L$(NETCDFLIB) -lnetcdf PS = -L. -lpsl GMT = -L. -lgmt LIB _C = fourt.c \ gmt_cdf.c \ gmt_customio.c \ gmt_grdio.c \ gmt_init.c \ gmt_io.c \ gmt_map.c \ gmt_plot.c \ gmt_shore.c \ gmt_stat.c \ gmt_support.c \ gmt_vector.c GMT_H = gmt.h \ gmt_math.h \ ...

Еще в разделе: (Показать все результаты (>319) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~ivan/gmt/man/grdfft.html
• http://xray.sai.msu.ru/~ivan/gmt/man/filter1d.html
• http://xray.sai.msu.ru/~ivan/gmt/man/grdfilter.html

... Faculty of Physics . M.V.Lomonosov Moscow State University . ... Source: Server administrator . ... M.V.Lomonosov Moscow state University announced a competition for the schoolboys within the frame of the project targeted at launching a sputnik by the university by the 250th jubilee of Moscow state. ... Conference web-site . ... 01.05.2003 New web-site . A new web-site of the Faculty of Physics, which has both a new structure and graphics design, has been launched to the test exploitation. ...

Еще в разделе: (Показать все результаты (>4131) - phys.msu.ru/ )

• Title

... 2015 . ... Professor emeritus, Trachtenberg School of Public Policy and Public Administration, George Washington University. ... This paper provides a critique of several of the key philosophical and psychological assumptions on which mainstream administrative ethics is typically based, followed by a discussion of four "counterintuitive" ethical propositions implied by that critique. ... Ethical guidance for public administrators, management, ethical discourse. ... Public Administrarion". ...

Еще в разделе: (Показать все результаты (>569) - ee-journal.spa.msu.ru/ )

О лаборатории . ... Лаборатория теоретической биофизики . ... Posted by Peter Mamonov in Без рубрики . ... ab initio basis sets cp2k education Firefly FRAP GAMESS gromacs MDAnalysis membrane mmb nano OPLS pymol python scipy sparse matrix toolset topology познавательно учебные материалы . OPLS-AA patch for different types of molecules . ... All-atom automatic OPLS-AA topology generator . ... OPLS-AA? in All-atom automatic OPLS-AA topology? ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>30) - erg.biophys.msu.ru/ )

• Gaussian Cube files loader ERG Research Group: Лаборатория теоретической
• Visualize partial charges in PyMol ERG Research Group: Лаборатория

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

... As an example of such graphic software environments it is possible to name software «Alice» (http://www.alice.org/), which created by «Stage3 Research Group» (Carnegie Mellon University) and allows designing the virtual 3-D worlds, interactive games, animated stories without special programmer abilities. ... In «Alice» it is possible to create various 3Dprojecs, with ready or imported, for example from «3D Studio», models, using animation, sound-effects and object's transformation. ...

Еще в разделе: (Показать все результаты (>162) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc15960/eng.pdf
• Software for testing in mathematics

Laboratories \ The security center of Biosystems \ Results . ... Results . ... Research development on the problem of "Ecotoxicology of environmental resistant organic pollutants by the example of investigation of the consequences of the chemical war of the USA in Vietnam" was generalized in the published in 2006 monograph "Dioxins and human health. ... In the process of research in Vietnam the new data of primary importance about toxic effects of dioxins on polluted by them territory were obtained: . ...

Еще в разделе: (Показать все результаты (>4518) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: example, with Rolex, showing
• Экологический Форум - Фундаментальная Экология: center China. the example, the
• Экологический Форум - Фундаментальная Экология: on the will example, refine