PROTOCOL OF THE BUSINESS MEETING OF THE COMMISSION ON PALEOPEDOLOGY AT THE IV INTERNATIONAL SYMPOSIUM AND FIELD WORKSHOP ON PALEOPEDOLOGY “PALEOSOLS AND CLIMATIC CHANGE” (July 28 and 30, Lanzhou, P.R. China) . ... It will contain the list of abstracts of the symposium in Lanzhou and some announcements regarding the INQUA Congress in Durban, S.A. NL 12 (May 1996) contains e.g. a detailed report of the Business Meeting of the PP - Commission at the last INQUA Congress 1995 in Berlin. ...

Еще в разделе: (Показать все результаты (>190) - www.fadr.msu.ru/ )

• PROTOCOL of Paleopedology Commission Business Meeting at V International
• PROTOCOL of Paleopedology Commission Business Meeting at XV INQUA Congress
• CONTENT:

... 8 OpenFlow , , , , , , NAT, ARP, DNS, DHCP, BGP , , web · ­ · events per second · >10M · "" ­ · us · ­ 24/7 · ­ : ­ (2013) · · · · · · · · · NOX-Classic NOX Beacon Floodlight SNAC Ryu POX Maestro Trema · · · · · · · · · Helios FlowER MUL McNettle NodeFlow Onix SOX Kandoo Jaxon · Cisco ONE controller · Nicira NVP Controller · Big Network Controller · IBM Programmable Network Controller · HP SDN Controller · NEC Programmable Flow 11 · ­ ­ · ­ · ­ · ­ OpenFlow 12 5/30/2013 13 (2013) · 7 000 000 . ...

Еще в разделе: (Показать все результаты (>9) - lvk.cs.msu.su/ )

PHP Manual . ... The PHP 3 debugger protocol is line-based. Each line has a type , and several lines compose a message . ... 1998-04-05 23:27:400966 lucifer.guardian.no(20481) start: notice . 1998-04-05 23:27:400966 lucifer.guardian.no(20481) message: Uninitialized variable . 1998-04-05 23:27:400966 lucifer.guardian.no(20481) location: ( NULL ):7 . 1998-04-05 23:27:400966 lucifer.guardian.no(20481) frames: 1 . 1998-04-05 23:27:400966 lucifer.guardian.no(20481) function: display . ...

Еще в разделе: (Показать все результаты (>606) - oit.cmc.msu.ru/ )

• 'Администрирование Novell NetWare 4
• CURL, Client URL Library Functions
• ldap_set_option

Second Announcement & Call for Papers THE CASPIAN REGION: ENVIRONMENTAL CONSEQUENCES OF THE CLIMATE CHANGE October 14-16, 2010 Moscow, Russia Organized by Geographical faculty M.V. Lomonosov Moscow state University DEAR COLLEAGUES! Organizing Co mmittee of the International Conference THE CASPIAN REGION: ENVIRONMENTAL CONSEQUENCES OF THE CLIMATE CHANGE thanks you for your interest to the Conference. ... This Conference will be held on October 14­16, 2010 in Moscow, Russia. ...

Еще в разделе: (Показать все результаты (>257) - www.geogr.msu.ru/ )

• http://www.geogr.msu.ru/science/conf/university/Kasp_2010_engl.pdf

Pentium 4 2.2 GHz . ... Pentium D 3.0 GHz, serial . Pentium D 3.0 GHz, parallel or multithreaded . ... input , output ) . ... Pentium 4 2.2 GHz , P4B (Northwood), 512 Kb L2 cache, no HTT support, 2200 MHz, 400 MHz FSB, 512 MB PC800 RamBus RIMM RDRAM, 60 GB IDE HDD, Windows 2000 Professional SP4. ... Serial - PC GAMESS is running using only one core . Parallel or multithreaded - PC GAMESS is running using only both cores in parallel (tests 1,3,5,6) or multithreaded (tests 2 and 4) modes. ...

Еще в разделе: (Показать все результаты (>106) - classic.chem.msu.su/ )

• PC GAMESS vs. WinGamess performance comparison
• PC GAMESS/Firefly DOCUMENTATION - running in parallel under Windows using
• PC GAMESS/Firefly DOCUMENTATION - running in parallel under Windows using WMPI

... We would be very pleased if you could join us for the 4 th Conference of International Society for Ecological Informatics (ISEI4) in Busan (Pusan), Korea, on October 24 ? 28, 2004. As you would probably heard from the first and second circulars, the theme of the conference is ?RUniversality o f information processing across different scales in ecology??, and many specialists on ecology/behavior, computation sciences and environmental studies will be present at ISEI4. ...

Еще в разделе: (Показать все результаты (>5281) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: Great T-shirts Title themselves
• Экологический Форум - Фундаментальная Экология: of also of rare, For October
• Экологический Форум - Фундаментальная Экология: an banner, second, a and should

... Home . ... Faculty . ... Your email * . ... Send to * . ... CMC MSU students at GSIS Summer School, Tohoku University, Japan . ... Second CMC MSU тИТ GSIS Tohoku Joint IT Seminar . ... CMC MSU тИТ GSIS Tohoku IT Joint Seminar . ... Delegation from Tohoku University (Japan) at CMC MSU . ... Invited lecture by Prof. Vijay Ganesh (University of Waterloo, Ontario, Canada) . The Faculty Site is in the adjustment state. ... 1996тАУ2016 €й Faculty CMC Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>253) - en.cs.msu.ru/ )

• Second CMC MSU тИТ GSIS Tohoku Joint IT Seminar | CMC MSU
• Laboratory of Information Systems Security | CMC MSU

... Supercomputing Technologies in Science, Education and Industry Almanac Series . ... Octotron: Active Control for Reliable Functioning of Supercomputers . ... DiMMon: a New Approach to Supercomputer Monitoring . ... X-COM: Distributed Computing Software . ... We propose a new approach to building distributed modular monitoring system named DiMMon, both for current and future systems, with an extremely high degree of parallelism. ... Research Computing Center (RCC) of Lomonosov Moscow State University...

Еще в разделе: (Показать все результаты (>70) - hpc.msu.ru/ )

• MSU's HPC HISTORY | Moscow University Supercomputing Center
• APPLICATIONS: Mathematics | Moscow University Supercomputing Center
• APPLICATIONS: Theoretical Physics | Moscow University Supercomputing Center

... Each day we feature a different image or photograph of our fascinating universe, along with a brief explanation written by a professional astronomer. October 17, 1995 . Galaxy Dwingeloo 1 Emerges . ... Explanation: If you look closely at the center of the above photograph, you will see a spiral galaxy behind the field of stars. ... In fact, all the individually discernible stars in the above photograph are in our Galaxy. ... About APOD | ... NASA Technical Rep.: ...

Еще в разделе: (Показать все результаты (>132) - www.arcetri.astro.it/ )

• APOD: October 16, 1995 - Starburst Galaxy M94
• APOD: 2000 October 23 - Dwarf Elliptical Galaxy NGC 205 in the Local Group
• APOD: 2000 November 8 - October Skylights

Second announcement VIII Moscow International Conference on Operations Research (ORM2016) Moscow, October 17-22, 2016 Dear colleagues, We invite you to attend the VIII Moscow International Conference on Operations Research. ... Lomonosov Moscow State University (MSU), Federal Research Center "Computer Science and Control" of RAS (FRC CSC RAS) and Russian Scientific Operations Research Society (RSORS) will organize the VIII Conference in October 2016 in Moscow. ... E-mail: ORM-2016@mail.ru. ...

Еще в разделе: (Показать все результаты (>21) - io.cmc.msu.ru/ )

• http://io.cs.msu.ru/ORM2016/ORM2016-1st_announ-ENG.pdf
• Кафедра Исследования Операций

... Heterogeneous networks and the ch_p4 device . ... mpirun -arch sun4 -np 3 -arch IRIX -np 3 program.%a While the ch_p4 device supports communication between workstations in heterogeneous TCP/IP networks, it does not allow the coupling of multiple multicomputers. ... This is only a benefit with the ch_p4 device. ... Up: Heterogeneous networks and the ch_p4 device Next: Heterogeneous networks of multicomputers and the ch_nexus device Previous: Heterogeneous networks and the ch_p4 device . ... Центры . ...

Еще в разделе: (Показать все результаты (>468) - www.parallel.ru/ )

• Bibliography | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Special features of different systems | PARALLEL.RU -
• More detailed control | PARALLEL.RU - Информационно-аналитический центр по

... О факультете . ... The Second White Sea Molecular Zoology Summer School . ... N.A.Pertzov White Sea Biological Station (WSBS MSU) invites undergraduate and graduate students studying zoology and ecology to participate in summer field school on Molecular Zoology, which will take place in September 5-19, 2010. ... Overview of major groups of invertebrates inhabiting the White Sea, determination of species with taxonomic keys, primer on zoological drawings. ... Биологический факультет МГУ . ...

Еще в разделе: (Показать все результаты (>8) - www.bio.msu.ru/ )

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Programs . ab is a tool for benchmarking your Apache Hypertext Transfer Protocol (HTTP) server. ... This especially shows you how many requests per second your Apache installation is capable of serving. ... The default is to just perform a single request which usually leads to non-representative benchmarking results. -p POST-file . ... Use a proxy server for the requests. -y <tr>-attributes . ...

Еще в разделе: (Показать все результаты (>605) - uneex.lorien.cs.msu.su/ )

• mod_dav - Apache HTTP Server
• apachectl - Apache HTTP Server Control Interface - Apache HTTP Server
• mod_expires - Apache HTTP Server

... Fast Facts about the Faculty of Journalism . ... Academic Departments . ... Partners . ... All partners . ... On October, 2014 February 2015 the students of the Faculty of Journalism, MSU were studying atљ Humboldt University of Berlin . ... Representatives of German party have repeatedly participated in educational programs organized by the Faculty of Journalism and the lecturers of the partner university are the regular guests of the house on the Mokhovaya street.љ ...

Еще в разделе: (Показать все результаты (>169) - www.journ.msu.ru/ )

• The Second International Media Readings in Moscow
• The Second International Media Readings in Moscow :: Факультет журналистики МГУ
• The 6th International Media Readings in Moscow ?Mass Media and

General Information . ... The conference is organized by the Sternberg Astronomical Institute (SAI) of Moscow University and the IAU Working group "Site-testing Instruments" . ... Use of site data in telescope operation and adaptive optics. ... Recent conferences on this subject (2007, 2008) demonstrated great interest of the community, hence the need for a new meeting. ... Unlike previous recent conferences, this meeting will cover all aspects of site monitoring for optical/IR astronomy. ...

Еще в разделе: (Показать все результаты (>223) - site2010.sai.msu.ru/ )

• Information
• Results of ELT site testing programs - II

... E-MAIL ADDRESS: D.Khmelev@newton.cam.ac.uk . A new statistical method in the analysis of literary style for disputed authorship resolution is considered here. ... Consider a sequence of letter of text as a Markov chain. ... Suppose we take the logarithm of each probability, change a sign, and divide it by the length of control text; then each of the numbers obtained is called the relative empirical entropy . Relative empirical entropy is more convenient for computing than actual probabilities. ...

Еще в разделе: (Показать все результаты (>57) - old.philol.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>196) - www.genebee.msu.ru/ )

• IGLA-3D User Guide

... Mathematical models and methods in VLSI design . ... General models and statements about the complexity of combinatorial tasks, methods for development of fast algorithms (method of dynamic programming, ?divide and conquer?, ?method of model extension?) are considered. ... Mathematical models of contemporary electronic circuits are considered and basic approaches to solving task of logic synthesis, as well as tasks of VLSI modules placement and interconnection routing are described. ...

Еще в разделе: (Показать все результаты (>245) - hcs.cmc.msu.ru/ )

• Master program "Mathematical Models of Complex Systems" | Магистерское и
• Master program "Network Software" | Магистерское и послевузовское образование
• Master program "Open Information Systems" | Магистерское и послевузовское

... The question is, how to get a machine with one network interface to respond to more than one IP addresses. ... changes (most likely only in the includes). ---------------------netinet/if_vif.h-------------------------------------- typedef struct { struct ifnet vif_if; struct ifnet *vif_sif; /* slave interface */ int vif_flags; } vif_softc_t; #define VIFMTU (1024+512) --------------------------------------------------------------------------- ...

Еще в разделе: (Показать все результаты (>108) - neptun.sai.msu.ru/ )

• Apache module mod_unique_id
• Manual Page: apachectl - Apache HTTP Server
• Apache module mod_expires

Proposals and projects in the Coordinated Call FP7-ICT-2011-EU- Russia Information Meeting Moscow: 21st October, 2010 EU- Russia Call · First ICT Joint Call with Russia (dedicated INCO Call in WP 11-12); joint calls have already been implemented in other areas of FP7 · Russia is investing in High Performance Computing: No 12 supercomputer in the top500 list is Russian; aiming to enter Top3 already in ...

Еще в разделе: (Показать все результаты (>91) - www.msu.ru/ )