... FORMATLIST: maniplulate a list of items; it is highly configurable to define what constitutes a list and how to extract items from it . ... expand="on,off" : toggle expansion of TWiki markup before filtering (defaults to on ) . ... exclude="...": remove list items that match this regular expression The pattern string shall group matching substrings in the list item to which you can refer to by using $1, $2, ... in the format string. ... format="...": format of each list item (default "$item") . ...

Еще в разделе: (Показать все результаты (>33906) - dualopt1.cmm.msu.ru/ )

• FilterPlugin - TWiki - TWiki

. Research Directions . Fundamental Problems of Automated Systems, Methodology, Technology and Security of Large-Scale Information Systems . Parallel Computing and Programming Tools . Mathematical Modelling, Computational and Applied Mathematics and Fundamental Applications . Modern Computational Technologies fof Teaching .

Еще в разделе: (Показать все результаты (>34) - srcc.msu.ru/ )

• Cluster analysis for pattern recognition in solar butterfly diagrams, AN, {\bf

Alternating direction implicit numerical method for 3D fluid flow simulation using GPU" . Berezin S.B., Paskonov V.M., Sakharnykh N.A. An efficient GPU implementation of the alternating direction implicit (ADI) numerical method in 3D domains is proposed. ... Keywords: alternating direction implicit method, parallel computing, GPU, Navier-Stokes equations . PostScript (in Russian) (892KB) . PDF (in Russian) (205KB) . PostScript. zip (in Russian) (394KB) . ...

Еще в разделе: (Показать все результаты (>40) - num-meth.srcc.msu.ru/ )

• "Mathematical simulation of creep processes in metal patterns made of materials

. [ Войти ] . Главная -> Фильмы -> No Direction Home: Bob Dylan . Пользователи . Демо . Деньги . Фильмы . Форум . No Direction Home: Bob Dylan . Япония - США - Великобритания 2005 . отметить . Документальный . Исторический . Музыкальный . Martin Scorsese . Liam Clancy . Allen Ginsberg . Bruce Langhorne . John Cohen . Dick Kangas . Mitch Miller . Paul Nelson . Bob Dylan . Mark Spoelstra . Tony Glover . Suze Rotolo . Izzy Young . B.J. Rolfzen . Maria Muldaur . Dave Van Ronk .

Еще в разделе: (Показать все результаты (>19) - kinfo.ru/ )

• Patterns - Фильмы - Kinfo.ru
• Patterns [1956] - Фильм - Фильмы - Kinfo.ru

... from designing patterns to sewing to wearing . ... cheap the north face . ... win 7 ultimate product key Windows 8 key windows 7 key win 7 key windows 7 pro product key win 7 pro product key windows 7 activation key windows 7 ultimate product key windows 7 ultimate serial key windows 7 key online win 7 ultimate key win 7 serial keys Win 7 ultimate key Win 7 ultimate product key windows 7 key sale win 7 ultimate product Key Windows 7 key ultimate win 7 ultimate ...

Еще в разделе: (Показать все результаты (>23) - elana.sinp.msu.ru/ )

• ralph lauren s | С Днем Победы!

Запись фильма . Запись фильма в программе WinView/32 . Версия 2.2.1.10 . 1998, Princeton Instruments Inc . ... верхнее положение - синхронизирован с камерой . среднее положение - закрыт . нижнее положение - открыт . Настройки программы для записи фильма . Experimental Setup . ... Number of images (число кадров фильма) ? ... CCD readout use region of interest . Accumulation 1 . ... overwrite/append append to . 3) ROI setup . ... end, end x/4 . ...

Еще в разделе: (Показать все результаты (>29) - cellmotility.genebee.msu.ru/ )

... Video tracking and behavior segmentation of laboratory rodents. Pattern Recognition and Image Analysis . ...

Еще в разделе: (Показать все результаты (>112) - graphics.cs.msu.ru/ )

• High-Quality Algorithm for Bayer Pattern Interpolation | Graphics and Media Lab
• High-Quality Algorithm for Bayer Pattern Interpolation | Лаборатория

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Re: [vim 7] есть тут активные юзвери - давайте делиться настройками [ re: monoid ] . ... Re: [vim 7] есть тут активные юзвери - давайте делиться настройками [ re: botWi ] . ...

Еще в разделе: (Показать все результаты (>984) - www.snto-msu.net/ )

• о локальных поисковиках [HOLYWAR! Win vs Lin] - Public forum of MSU united

... Credit Copyright: BICEP2 Collaboration , NSF , Steffen Richter (Harvard) Explanation: Did the universe undergo an early epoch of extremely rapid expansion? ... Yesterday, results were released showing an expected signal of unexpected strength, bolstering a prediction of inflation that specific patterns of polarization should exist in cosmic microwave background radiation -- light emitted 13.8 billion years ago as the universe first became transparent . ... NASA Official: Jay Norris. ...

Еще в разделе: (Показать все результаты (>3072) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"
• Airplane Flight Patterns over the USA
• Астронет > Airplane Flight Patterns over the USA

... О UNИX . ... HelpOnTables . ... Table Markup . ... General table layout and HTML like options . ... Line breaks within cells . ... Bulleted lists and other complex content within cells To create a table, start & end a new line using the table marker; two 'pipe' characters " || ... top left cell || top right cell || || bottom left cell || bottom right cell || ... Just use CSS-formatted styles and it will be inlined in the generated HTML tag. <style="..."> will put that style info into cell (td) html ...

Еще в разделе: (Показать все результаты (>117) - uneex.mithril.cs.msu.su/ )

... О UNИX . ... HelpOnTables . ... Table Markup . ... General table layout and HTML like options . ... Line breaks within cells . ... Bulleted lists and other complex content within cells To create a table, start & end a new line using the table marker; two 'pipe' characters " || ... top left cell || top right cell || || bottom left cell || bottom right cell || ... Just use CSS-formatted styles and it will be inlined in the generated HTML tag. <style="..."> will put that style info into cell (td) html ...

Еще в разделе: (Показать все результаты (>248) - uneex.lorien.cs.msu.su/ )

• The Edit Menu
• Issues Regarding DNS and Apache - Apache HTTP Server
• Таблицы

... Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures is very young. We have grown up in the laboratory of laser spectroscopy of water media. ... Use of such powerful modern tools of solution of inverse problems and problems of optimization provides successful solution of a wide range of applied problems of diagnostics and analysis of water media. ... 2016 Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures . ...

Еще в разделе: (Показать все результаты (>23) - rswater.phys.msu.ru/ )

... Screening pattern or alignment against protein databank . ... Protein databanks . SWISSPROT protein databank PDB: Biopolymer 3D structures . ... Pattern Alignment . ... Pattern (or alignment) . Pattern example 1: . ... Alignment example: . FA9_CAVPO GPHVTEVEGTNFLTGIISWGEE-CAMKGKYGIYTKVSRYVNW- FA9_PIG GPHVTEVEGTSFLTGIISWGEE-CAVKGKYGIYTKVSRYVNW- KAG_PIG GPLICNGM----WQGITSWGhtpCGSANKPSIYTKLIFYLDWI FA9_CAVPO FCAGFHEGGRDSCQGDSG FA9_PIG FCAGFHEGGKDSCLGDSG KAG_PIG LCAGYLPGGKDTCMGDSG . ...

Еще в разделе: (Показать все результаты (>91) - www.genebee.msu.ru/ )

• Screening of pattern or alignment against PROTEIN databank

Fig. 1. Temperature dependence of resistivity R(T) for Pb 0.8 Sn 0.2 Te 1-y Se y samples. 1 - y=0, 2 - y=0.05, 3 - y=0.25, 4 - y=0.33, 5 - y=0.5, 6 - y=0.67, 7 - y=0.83. Curves 3-7 are shifted up by 35, 55, 75, 130, and 165 units, respectively. All samples are of n-type. Arrows indicate the direction of temperature change during recording the curves. The insert shows the dependence of T c on y.

Еще в разделе: (Показать все результаты (>38) - scon155.phys.msu.su/ )

• http://semiconductors.phys.msu.ru/publ/f17.html
• The Physics of Semiconductors division of MSU

... We consider now change-points in different components of the frequency spectrum of typical EEG signal. ... Only few change-points in power are found in the initial EEG (unless a prominent alpha rhythm is present). ... Change-points in different frequency components of the EEG . ... Change-points in different types of the EEG alpha activity without substantial gradual changes . ... As can be seen from Fig. 7.3, the program reliably detected the change-points despite of such variety of signal patterns...

Еще в разделе: (Показать все результаты (>47) - brain.bio.msu.ru/ )

Evaluation of seed plants dispersed on either side of the tropical Atlantic, specifically South America and Africa, by wind and sea currents. ... From current data, it appears sea currents have been responsible for dispersals in either direction, while winds seem to play more of a role in transport from South America to Africa. ... It is more difficult to account for dispersal events inferred to have been due to winds blowing from South America to Africa. ...

Еще в разделе: (Показать все результаты (>73) - herba.msu.ru/ )

• Department of Mycology and Algology
• Plant Physiology Department

Б.П. Леонтьев . ... The very first problem is to select American Educational Materials (AEM), which are of high quality and wide nomenclature. ... Analysis undertaken in [ 1,3 ] revealed time patterns in this process. Time milestones are given to work out original educational and research products, which are based on redesign of AEM and on intercultural experience acquired during participation in JFDP. ...

Еще в разделе: (Показать все результаты (>30) - www.prof.msu.ru/ )

Myotis . Uropatagium venation pattern in bats as diagnostic character (by the example of genus Myotis ) . ... By the example of genus Myotis it was shown that venation pattern on uropatagium of bats in some cases can be used as diagnostic character. Venation features on uropatagium allow easy to separate Daubentonв?Ts bat, eastern water bat, big-footed bat, and pond bat from Brandtв?Ts bat, Siberian bat, whiskered bat, and Ikonnikovв?Ts bat. ... Bats]. ... Bats of the Russian Far East]. ...

Еще в разделе: (Показать все результаты (>775) - zmmu.msu.ru/ )

• Cranial and skeletal growth patterns in red foxes (Vulpes vulpes L., 1758)
• Russian Journal of Theriology
• Geographical pattern and historical demography of Midday gerbil Meriones

Laboratory of Ferroelectricity . Directions of reseach . ... Reseach . Members . ... The main direction of the scientific reseach is : . The investigation of the influence of size effects and impurities on physical propertes and phase transitions in ferroelectrics. In the framework of this direction members of the laboratory provide the investigation of phase transitions in ferroelectrics, the investigation of dielectric, thermal properties of ferroelectric crystals. ... Main Page . ...

Еще в разделе: (Показать все результаты (>13) - ferro.phys.msu.ru/ )

• Department of General Physics and magneto-ordered matter. Physics Faculty of

Lab . Main page News People . ASA . Master . Master net Homepage . ... Lomonosov Moscow State University Sternberg Astronomical Institute . ... MASTER . ... Lomonosov (ShOK) . ... About Space Monitoring Laboratory, scientific directions, instruments, contacts . People, who work in lab . Latest news and news archive . ... Gamma-Ray Bursts observations . Theory of Gamma-Ray Burst formation . ... MASTER (Global Robotic optical monitoring system) . ... All news ...

Еще в разделе: (Показать все результаты (>182) - master.sai.msu.ru/ )