... Write {{ note text }} anywhere in a topic. ... FOOTNOTE{LIST="Web.Topic"}% will be replaced by the notes from an %INCLUDE% ed page. ... Tim Berners-Lee{{Tim Berners-Lee is now director of the World Wide Web Consortium, and Professor of Computer Science at Southampton ECS.}} invented the World Wide Web. ... Tim Berners-Lee (1) invented the World Wide Web. ... Notes 1 : Tim Berners-Lee is now director of the World Wide Web Consortium, and Professor of Computer Science at Southampton ECS. ...

Еще в разделе: (Показать все результаты (>18889) - wiki.cs.msu.ru/ )

• JQueryLoader < System < Foswiki

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>14) - storage.bioinf.fbb.msu.ru/ )

... 1: // file account_ server .cc 2: 3: #include iostream.h 4: #include fstream.h 5: #include account.h 6: 7: class Account_impl : ... public Account_skel 8: { 9: // unchanged, see section MICO Application 10: // ... 11: }; 12: 13: 14: int main( int argc , char * argv [] ) 15: { 16: // ORB initialization 17: CORBA :: ORB _var orb = CORBA :: ORB _init( argc , argv , mico-local- orb ); 18: ... Compile the client and server programs like this: . ...

Еще в разделе: (Показать все результаты (>656) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - aclock/aclock.cpp example file
• Qt Toolkit - drawdemo/drawdemo.cpp example file
• Example

Электронная библиотека Попечительского совета . ... Maarten H. - Discogenic Low Back Pain. Lumbar spondylodesis revisited . ... Название: Discogenic Low Back Pain. ... Although low back pain has been reported since many centimes, tins complex entity of pathophysiological, biomechanical, psychological and social factors, in fact, can be considered as a post- World War II phenomenon in Western society. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>10869) - lib.mexmat.ru/ )

• KroahHartman G. - Linux Kernel in a Nutshell :: Электронная библиотека
• Raghavachary S. - Rendering for Beginners: Image Synthesis Using RenderMan ::
• Elberly D.H., Shoemake K. - Game Physics :: Электронная библиотека

. Princip Muravya - Flash-animation . Princip Muravya - Music example (download - 4.31 Mb) . Back

Еще в разделе: (Показать все результаты (>137) - polly.phys.msu.ru/ )

• Useful information
• Anna Bodrova

... Revision Log Mode: Stop on copy Follow copies Show only adds and deletes View log starting at and back to . ... edit) . ... 5 years . me.dendik . ... Added rule to evade trapping yourself while eating for e4 snake . ... Added "run mostly forward" rule to e2 snake . ... Changed display names in e2, e4 snakes (they were both Example тАж . ... e4 snake now tries to zig-zag . ... Added two smarter snakes: e2 and e4 . ... snakes added . ... Added example empty snake . ... Added example snake . ...

Еще в разделе: (Показать все результаты (>848) - kodomo.cmm.msu.su/ )

• screens (log) тАУ Python Battle

Clethrionomys Tilesius, 1850 is the valid generic name for red-backed voles and Myodes Pallas, 1811 is a junior synonym of Lemmus . Clethrionomys Tilesius, 1850 is the valid generic name for red-backed voles and Myodes Pallas, 1811 is a junior synonym of Lemmus Link, 1795 . ... An analysis of 19th century zoological literature shows widespread usage of Myodes as the generic name for Norway and Siberian lemmings (currently genus Lemmus Link, 1795). ... Pallas P.S. 1811. ...

Еще в разделе: (Показать все результаты (>1139) - zmmu.msu.ru/ )

• Phylogeography of the gray red-backed vole Craseomys rufocanus (Rodentia:
• Uropatagium venation pattern in bats as diagnostic character (by the example of
• XIV International Ornithological Conference of North Eurasia: Registration

... ClibPDF lets you create PDF documents with PHP. ... php $ radius = 200; $margin = 20; $pagecount = 40; $ pdf = cpdf _open(0); cpdf _set_creator($ pdf , pdf _clock.php3 ); cpdf _set_title($ pdf , Analog Clock ); while($pagecount-- 0) { cpdf _page_init($ pdf , $pagecount+1, 0, 2 * ($ radius + $margin), 2 * ($ radius + $margin), 1.0); cpdf _set_page_animation($ pdf , 4, 0.5, 0, 0, 0); /* wipe */ cpdf _translate($ pdf , $ ... cpdf_set_creator -- Sets the creator field in the pdf document ...

Еще в разделе: (Показать все результаты (>963) - oit.cmc.msu.ru/ )

• GregorianToJD
• Ovrimos SQL functions
• unserialize

1999-2016 Gentoo Foundation # Distributed under the terms of the GNU General Public License v2 # $Id$ EAPI=5 JAVA_PKG_IUSE= examples doc source inherit java-pkg-2 java-ant-2 eutils DESCRIPTION= A Java-based template engine for easy creation/rendering ... /engine/${PV}/${P}.tar.gz LICENSE= Apache-2.0 SLOT= 0 KEYWORDS= amd64 x86 ~x86-fbsd IUSE= test CDEPEND = dev-java /commons-collections:0 ...

Еще в разделе: (Показать все результаты (>29798) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/dev-java/velocity/velocity-1.7-r1.ebuild
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/bcp/bcp32.txt
• http://mirror.msu.net/pub/gentoo-portage/dev-lang/scala/scala-2.10.3-r2.ebuild

grdfft - Perform mathematical operations on grdfiles in the frequency domain grdfft in _ grdfile -G out _ grdfile [ -A azimuth ] [ -C zlevel ] [ -D [ scale |g ] ] [ -E [ x|y ][ w ] ] [ -F [ x | ... The horizontal dimensions of the grdfiles are assumed to be in meters. ... Append a scale to multiply by (kr * scale ) instead. Alternatively, append g to indicate that your data are geoid heights in meters and output should be gravity anomalies in mGal. Default is no scale]. ...

Еще в разделе: (Показать все результаты (>602) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~ivan/gmt/man/grdproject.html
• http://xray.sai.msu.ru/~ivan/gmt/man/psclip.html
• http://xray.sai.msu.ru/~ivan/gmt/man/psscale.html

Примеры из книги О.Д.Авраамовой . ... 5_2.WRL Повторное использование объектов (лучше смотреть с отмеченной опцией "wireframe rendering" браузера, поскольку сфера находится внутри куба и обычным образом видна не будет) . 6_1.WRL Эллипсоид вращения (пример использования узла Transform) . ... 8_2.WRL Пример иллюстрирует использование вариабельности разных полей узла Material. ... Для того, чтобы пример работал и на вашем локальном диске, не забудьте скопировать файл 12_3.WRL . ...

Еще в разделе: (Показать все результаты (>2) - www.srcc.msu.ru/ )

... Library Example #2 . Up: Motivating Examples Next: Inter-Communication Previous: Library Example #1 . ... main(int argc, char **argv) { int ma, mb; MPI_Group MPI_GROUP_WORLD, group_a, group_b; MPI_Comm comm_a, comm_b; . static int list_a[] = {0, 1}; #if defined(EXAMPLE_2B) | defined(EXAMPLE_2C) static int list_b[] = {0, 2 ,3}; #else/* EXAMPLE_2A */ static int list_b[] = {0, 2}; #endif int size_list_a = sizeof(list_a)/sizeof(int); int size_list_b = sizeof(list_b)/sizeof(int); .. ...

Еще в разделе: (Показать все результаты (>527) - www.parallel.ru/ )

• Examples using MPI_SCATTER, MPI_SCATTERV | PARALLEL.RU -
• Examples | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Symmetric Multiprocessors (SMPs) | PARALLEL.RU - Информационно-аналитический

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . Alt >> Flood.GayStyle >> back to basics! ... Рег.: ... Рейтинг: 46 . Re: back to basics! [ re: agata ] . ... Рейтинг: -104 . Re: back to basics! [ re: kollega ] . ...

Еще в разделе: (Показать все результаты (>7345) - www.fds-net.ru/ )

• S04E10. Something Nice Back Home - Public forum of MSU united student networks
• TP CS 5x5 part2 un strikes back - Public forum of MSU united student networks
• новая Futurama - The Beast with a Billion Backs - Public forum of MSU united

... Новости . ... Анекдоты . ... Форум . ... Мехмат , история , декан . Отделения: математики , механики , вечернее . ... MMOnline Информационный портал о мехмате МГУ . ... MMOnline и мехмат МГУ ждут вас. ... 21 июня Магистратура мехмата МГУ проведет День открытых дверей . ... Проект 'Математический форум мехмата МГУ' вышел в финальную часть конкурса 'Золотой сайт 2010' . ... На мехмате начинает работу научный семинар Современные проблемы математики и механики . ... Математический форум мехмата МГУ . ...

Еще в разделе: (Показать все результаты (>10473) - www.mmonline.ru/ )

• До 1 ноября Springer предоставляет бесплатный доступ к более чем 150

This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>113) - neptun.sai.msu.ru/ )

• Using Apache with HP MPE/iX
• Compiling Apache for Microsoft Windows
• Apache module mod_negotiation

GDE alignment format is one of standard alignment formats. A popular program for sequence alignment, Clustal, for example, can save alignment in this format. In this format, all letters indicating amino acids are in lower case, gaps are indicated by dashes. Sequences are placed one after another, name of each sequence is placed onto a separate line and begins with ‘%’. The sequence is placed afterwards beginning on the next line and may be broken into several lines. ...

Еще в разделе: (Показать все результаты (>142) - bioinf.fbb.msu.ru/ )

• Alignment example
• SDPlight
• User's guide

Supernova 1999gs in NGC 4725 . This is a prediscovery image of 1999gs in NGC 4725 taken by Marco Migliardi on December 23.21 1999, during the CROSS Program with the Col DrusciХ 20" "Helmut Ullrich" telescope. This image was taken 5 days before the "discovery" image of 1999gs which was taken by LOSS this image shows a significantly brighter SN than the discovery image shows. ... Back to Bright Supernovae . Back to Bright Supernovae - 1999 . ...

Еще в разделе: (Показать все результаты (>488) - www.rochesterastronomy.org/ )

• Supernova 2002fk in NGC 1309
• Supernova 2009js in NGC 918
• Supernova 2000au in MCG +8-15-14

downloads ]] . CompHEP . ... This is a list of pages that seem to link back to the current page. sidebar . ... Downloads . Community contributions . Community model library . ... License . ... Installation guide . ... CompHEP-3.3 Manual . CompHEP-3.3 Manual (pdf) . ... downloads.txt Last modified: 2014/10/07 18:43 (external edit) . Except where otherwise noted, content on this wiki is licensed under the following license: CC Attribution-Noncommercial-Share Alike 3.0 Unported . ...

Еще в разделе: (Показать все результаты (>96) - comphep.sinp.msu.ru/ )

• download:cpythwarning [CompHEP]
• download:main [CompHEP]
• download:rn-031116 [CompHEP]

... Structure of Data . ... Catalog . ... The SAI OCL Catalog site provides several VO-enabled modes of operation: . VO-enabled catalog data analysis from a browser . ... Endpoint URL is http://ocl.sai.msu.ru/catalog/conesearch/ . ... VO-enabled catalog analysis from a browser . Presently, this recipe works with Firefox (Windows, MacOS, Linux), Internet Explorer (Windows) and Opera (Windows) browsers with Java plugin 1.6 installed. ... Main TOPCAT window with SAI OCL catalog loaded will appear. ...

Еще в разделе: (Показать все результаты (>215) - ocl.sai.msu.ru/ )

... Corporate Social Policy as an Approach to Managing the Workforce: Some Examples from U. S. History, . ... Corporate social policy is one of the most significant subjects studied by business historians. To attract workers and maintain sound businesses some Russian entrepreneurs adopted paternalistic social welfare policies, described in several recently published works. ...

Еще в разделе: (Показать все результаты (>77) - hist.msu.ru/ )