... Creating Subpackages . ... Name: foo Version: 2.7 Release: 1 Source: foo -2.7.tgz CopyRight: probably not Summary: The foo app, and the baz library needed to build it Group: bogus/junque % description This is the long description of the foo app, and the baz library needed to build it... %package server Summary: The foo server Group: bogus/junque % description server This is the long description for the foo server ... %package ... Spec File Changes For Subpackages . ...

Еще в разделе: (Показать все результаты (>698) - uneex.lorien.cs.msu.su/ )

• HelpOnUpdating - UNИX
• Converting Modules from Apache 1.3 to Apache 2.0 - Apache HTTP Server
• htpasswd - Manage user files for basic authentication - Apache HTTP Server

... О UNИX . ... HelpOnUpdating . ... The directory containing the MoinMoin code files (e.g. /usr/lib/python*.*/site-packages/MoinMoin ) . after you have a backup of this, you might want to delete the MoinMoin directory there to avoid having old code files there that are not overwritten by the new code, but maybe interfering with it) . ... Make sure python can find the MoinMoin code package and your wiki configuration files (fix sys.path in the server adaptor script or PYTHONPATH in the environment). ...

Еще в разделе: (Показать все результаты (>311) - uneex.mithril.cs.msu.su/ )

• HelpOnThemes - UNИX
• HelpOnInstalling/TroubleShooting - UNИX
• HelpOnConfiguration - UNИX

... The lists of flora of Kem-Ludy archipelago (Russian White Sea, near Arctic Circle) produced in years 1962 and 2001-2004 were investigated by different methods of data analysis. The full species list contains 284 species. 27 islands were studied, four new islands were appeared due to the tectonic events. ... Most important factors are island square and openness (accessibility for winds). ... Marine birds are most important biological factor for island flora maintenance. ...

Еще в разделе: (Показать все результаты (>208) - herba.msu.ru/ )

• Systema Naturae
• ALGAE AND THEIR CHANGES OVER TIME
• Изменения морфологии кувшинки при обработке живого материала

... Next: Turning sound on Up: Additional commands Previous: Actions with obtained files Contents Index . Obtained files are stored with filenames that were given according to the information you entered during connection ( 2.2.1 section). If you want to change these names, select SPM/ File names... menu command. Window that contains 6 pairs of fields (pic. 2.16 ) will appear. ... When new file appears number in the second pair field increased by 1. ...

Еще в разделе: (Показать все результаты (>113) - www.spm.genebee.msu.ru/ )

• Change in inner data representation
• Changing Image Resolution
• Changing window size

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>216) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• OUTPUT
• BLAST Frequently Asked Questions (FAQ)

The database of triplet periodicity change points Y.M. Suvorova, E.V. Korotkov Centre of Bioengineering Russian Academy of Sciences, 117312, prospect 60 -tya Oktyabrya 7/1, Moscow, Russia, suvorovay@gmail.com It is well-known that triplet periodicit y (TP) is the dist inguishing feature of protein coding sequences of the majorit y of the living organisms [1]. ... The current version o f the database includes 179 238 records of protein coding sequences with triplet periodicit y change points. ...

Еще в разделе: (Показать все результаты (>292) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/167.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/237.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/47.pdf

ChangeLog for / # # Generated by Trac 0.12.5 # 04/11/16 15:49:58 Mon , 20 Dec 2010 13:12:55 GMT Daniil Alexeyevsky me.dendik@тАж [34:b7a85caedc7f] * body.py ( added ) * game.py ( added ) * tk_ui.py ( added ) * user.py ( added ) * vector.py ( added ) Re-imported files after merge Mon , 20 Dec 2010 13:11:34 GMT Daniil Alexeyevsky me.dendik@тАж [33:a92686be9c95] * body.py (deleted) * ...

Еще в разделе: (Показать все результаты (>753) - kodomo.cmm.msu.su/ )

• http://kodomo.cmm.msu.su/trac/tanchiki/log/?format=changelog&rev=33%3Aa92686be9c95&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/tanchiki/log/?format=changelog&rev=a92686be9c95c31b91d91aa1be6952eb5cfb02bb&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/tanchiki/log/?format=changelog&rev=b7a85caedc7f13c63a83881fb25b2c4e371a63e7&limit=100&mode=stop_on_copy

Лаборатория концентрирования, общая информация . ... общих вопросов аналитической химии (история, терминология, география, кадры, популяризация и др.; академик Ю.А. Золотов); . сорбционного концентрирования элементов, органических соединений и поиска новых сорбентов (группы д.х.н. Г.И. Цизина, д.х.н. С.Г. Дмитриенко, д.х.н. Е.И. Моросановой); . разработки экспрессных тест-методов химического анализа, главным образом вне лаборатории (группы д.х.н. Е.И. Моросановой, д.х.н С.Г. Дмитриенко); . ...

Еще в разделе: (Показать все результаты (>31) - analyt.chem.msu.ru/ )

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . ... Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: to Six the changed this of as Matteo in W . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . Вы не можете публиковать новые темы в этом форуме . ...

Еще в разделе: (Показать все результаты (>3292) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: changed, luxury domestic
• Экологический Форум - Фундаментальная Экология: rare. get changed of growth
• Экологический Форум - Фундаментальная Экология: You attitude to change can

... METHOD . ... public interface AttributeSet . AttributeSet is an inquiry interface for a collection of Attributes. ... Tests if the Attribute identified by name is in this set. ... Retrieve the attribute associated with the specified name. ... Returns AttributeIterator for the elements. ... a new Array containing the elements of this set. public Attribute get (java.lang.String name) . ... If a different Attribute with the same name, was in the set, it is returned, otherwise null is returned. ...

Еще в разделе: (Показать все результаты (>88) - angel.cs.msu.su/ )

• : Class Schema
• Appendix D NetCDF 2 C Transition Guide
• Index

. [ Войти ] . Главная -> Фильмы -> How William Shatner Changed .. Пользователи . Демо . Деньги . Фильмы . Форум . How William Shatner Changed the World . Канада 2005 . отметить . Документальный . Фантастика .

Еще в разделе: (Показать все результаты (>143) - kinfo.ru/ )

• The Day the Universe Changed - Фильмы - Kinfo.ru
• Steve Irwin: He Changed Our .. - Фильмы - Kinfo.ru
• The Man Who Changed His Mind - Фильмы - Kinfo.ru

. Requires JavaScript . AA sequence . (3-letter code) . AA sequence . (1-letter code) . 2000 Author Sergey Zaitsev

Еще в разделе: (Показать все результаты (>1838) - monkey.belozersky.msu.ru/ )

• SDPpred
• SDP home page
• Inquiry information || Parsimony algorithm

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... продаю чайник " Philips "!!(price has changed) . ... Re: продаю чайник " Philips "!! [ re: shield ] . ... IT IS WORKING IN EXCELLENT STATUS?? ...

Еще в разделе: (Показать все результаты (>6342) - www.fds-net.ru/ )

• Детализация рейтинга: Changes - Public forum of MSU united student networks
• Active Directory смена пароля - Public forum of MSU united student networks
• Настройка cvsup во FreeBSD 6.2 для новичка. - Public forum of MSU united

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... changed ]как поиграться в Ларри, который на \\Ultra лежит . ... Re: как поставить Ларри, который на \\Ultra лежит [ re: Kirillay ] . ...

Еще в разделе: (Показать все результаты (>4876) - www.snto-msu.net/ )

• Детализация рейтинга: Changes - Public forum of MSU united student networks
• Настройка cvsup во FreeBSD 6.2 для новичка. - Public forum of MSU united
• комиксзона + - Public forum of MSU united student networks

... Download NPG-explorer . ... Build nucleotide pangenome . ... Here we provide a table for 3 Brucella genomes: all: embl :CP002459 BRUMM chr1 c Brucella melitensis M28 chromosome 1 all: embl :CP002460 BRUMM chr2 c Brucella melitensis M28 chromosome 2 all: embl :CP003176 BRUAO chr1 c Brucella abortus A13334 chromosome 1 all: embl :CP003177 BRUAO chr2 c Brucella abortus A13334 chromosome 2 all: embl :CP002078 BRUPB chr1 c Brucella pinnipedialis B2/94 chromosome 1 all: ... Fix bugs....

Еще в разделе: (Показать все результаты (>7051) - mouse.belozersky.msu.ru/ )

• S : rm_systems
• Amino Acid Changer
• PLANdbAffy: probe-level annotation database for Affymetrix expression

... Given package is a set of special commands and their handler - JOB program. The command aimed for description of often performed operations with files of PC-GAMESS program (dat, out, pun). ... Commands allow running calculation, performing other programs, data change between files and modification of files. ... Command inserts specified group in file.inp. ... del_g h2o.dat |Command deletes all repetition of| |$basis |specified group in file.inp. ... Command changes contents of group on specified | ...

Еще в разделе: (Показать все результаты (>87) - classic.chem.msu.su/ )

• Firefly v. 8.0.0 documentation - numerical gradients
• PC GAMESS/Firefly DOCUMENTATION - running in parallel using LAM/MPI
• Firefly and PC GAMESS Version History

fitshdr_edit - FITS-file headers interactive editor fitshdr_edit [options] FITSfile_name . fitshdr_edit utility allows to modify FITS headers' lines interactively (FITS MultiExtentionsFiles included). fitshdr_edit is just simple shell script around fitshdr utility. ... It means, that You can't remove line from header! ... 560:CRDELT2 = 21.0 / this is example 640: 720:HISTORY header No.0: 1st history line 123456789012345678901234567 880:COMMENT Sat Sep 25 21:17:34 CEST 2004 / by fitshdr_edit . ...

Еще в разделе: (Показать все результаты (>184) - lnfm1.sai.msu.ru/ )

• FITShdr: INSTALL
• IDL programs
• Manpage of FITSHDR

... This file is maintained via ncm-krb5clt(1), local changes may be lost. If you need to add your realm, look at the template file ; in /usr/lib/ncm/config/krb5clt/etc_krb5.conf.tpl ; or get in touch with project-elfms@cern.ch [libdefaults] default_realm = CERN.CH ticket_lifetime = 25h renew_lifetime = 120h forwardable = true proxiable = true [realms] CERN.CH = { default_domain = cern.ch kpasswd_server = afskrb5m.cern.ch admin_server = afskrb5m.cern.ch kdc = afsdb2.cern.ch ...

Еще в разделе: (Показать все результаты (>12) - lhe.sinp.msu.ru/ )

• http://lve.sinp.msu.ru/~rud/Atlas/soft/configuration.log1

... Войти в систему . ... 2015 Holocene environmental changes in southern Kamchatka, Far Eastern Russia, inferred from a pollen and testate amoebae peat succession record // Global and Planetary Change . Klimaschewski?L A. , Barnekow?K D. , Bennett A.A. , Andreev E., Andr?n A.A. , Bobrov , Hammarlund D. в журнале Global and Planetary Change , издательство Elsevier BV (Netherlands) , с. 1-8 DOI . ... в журнале Global and Planetary Change , издательство Elsevier BV (Netherlands) , том 102, с. 1-9 DOI . ...

Еще в разделе: (Показать все результаты (>2462) - istina.msu.ru/ )

• Global Change Biology - журнал | ИСТИНА - Интеллектуальная Система
• Technological Forecasting and Social Change - журнал | ИСТИНА -
• Nature climate change - журнал | ИСТИНА - Интеллектуальная Система

May 12, 1998 NOTES from May 9, 1998: The format of the Solar Event Lists was changed to include a standard SEC style header. ... Please send comments and suggestions to sec@sec.noaa.gov # # Missing data: //// # # Edited Events for 1998 May 11 # # Event Begin Max End Obs Q Type Loc/Frq Particulars Reg# #------------------------------------------------------------------------------- 2560 A0146 //// 1225 HOL ... The UT day of the event's begin time is the UT day of the list. ...

Еще в разделе: (Показать все результаты (>4) - dbserv.sinp.msu.ru/ )