Each FileAttachment in a Topic can have additional attributes. At present only the H (hidden) attribute is supported. If this attribute is set then the attachment is considered to be hidden. ... Related Topics:* UserDocumentationCategory . This topic: System > WebHome > UsersGuide > FileAttachment > FileAttribute . Topic revision: 12 Apr 2009, ProjectContributor (raw view) . Copyright by the contributing authors. ... Ideas, requests, problems regarding Foswiki? ...

Еще в разделе: (Показать все результаты (>1742) - wiki.cs.msu.ru/ )

... Next . 3.0.12 - 3.0.18 only, PHP 4 >= 4.0.0) cpdf_add_annotation -- Adds annotation . void cpdf_add_annotation ( int pdf document, float llx, float lly, float urx, float ury, string title, string content [, int mode]) . The cpdf_add_annotation() adds a note with the lower left corner at ( llx , lly ) and the upper right corner at ( urx , ury ). The optional parameter mode determines the unit length. If it's 0 or omitted the default unit as specified for the page is used. ...

Еще в разделе: (Показать все результаты (>231) - oit.cmc.msu.ru/ )

• Java Distributed Computing course annotation
• pdf_add_annotation
• hw_InsertObject

... Dark matter in normal galaxies . ... I will pay attention to such issues as the constraints on dark matter profile, micro-lensing counts from the galactic bar, rotation and the structure of the bar. One of the central issues of the modeling is the exchange of the angular momentum between the disk and the dark matter. ... Our results indicate that in realistic models the exchange of angular momentum between the bar and the dark matter is much smaller than previously estimated. ...

Еще в разделе: (Показать все результаты (>213) - xray.sai.msu.ru/ )

• AXAF-Chandra
• Ivan's contribution to GMT 3.2

... Previous message: [RU-NGI] Environments on SL6/EMI-3 WNs . Next message: [RU-NGI] SL6 additional RPMs . Messages sorted by: [ date ] [ thread ] [ subject ] [ author ] . ... Так как мы начали перебираться на SL6, возник такой вопрос: какие дополнительные пакеты необходимо бы поставить для экспериментов на WN, которые не входят в стандартный набор HEP_OSlibs_SL6-1.0.13-0.el6.x86_64.rpm? Никто не наступал на грабли ещё из перешедших на SL6? ... More information about the RU-NGI mailing list . ...

Еще в разделе: (Показать все результаты (>262) - theory.sinp.msu.ru/ )

• [RU-NGI] proxy @ nagios - rnag1.grid.kiae.ru

... Next: Fast probe landing and Up: Client Previous: Photodiode (AFM mode) Contents Index . FemtoScan `` client-program has a number of additional commands to work with during scanning. These commands allow to execute some special operations on microscope control and interface configuration. ... Fast probe landing and retraction . ... Images saving mode . ... Next: Fast probe landing and Up: Client Previous: Photodiode (AFM mode) Contents Index Filonov 2005-02-04 ...

Еще в разделе: (Показать все результаты (>44) - www.spm.genebee.msu.ru/ )

• Additional data acquiring channels
• FemtoScan Online program
• Format of Legend

... About lab . ... Conference "GraphiCon" . Online Journal "Computer graphics and multimedia" (in russian) . ... Age Estimation Using Additional Unlabeled Face Images . ... Conference Paper . ... Age estimation , Face classification , Local Binary Pattern , machine learning . ... Automatic age estimation from face images is an important and actual problem due to its practical significance. ... Most face recognition databases meet this condition and enable age estimation rate improvement. ...

Еще в разделе: (Показать все результаты (>84) - graphics.cs.msu.ru/ )

• Age Estimation Using Additional Unlabeled Face Images | Лаборатория
• Simultaneous facial attribute classification with convolutional neural networks
• How diamond performance attributes: brilliance, scintillation and fire depend

SCIENTIFIC TASKS AND RESULTS . In the results of searching for new perspective solid state materials for the quantum electronics, non-linear optics and other fields of physics more than 200 various oxide compounds were synthesized and peculiarities of their atomic structure and physical properties are studied. Single crystals of 80 such the compounds are grown and thoroughly investigated. ... A family of oxide-ion conductors on the base of La 2 Mo 2 O 9 (30.10.09) . ... Main page ...

Еще в разделе: (Показать все результаты (>38) - polly.phys.msu.ru/ )

... 2016, issue ? 1 : Annotation . ... 1 : Contents . 2015, issue ? ... 2014, issue ? ... 2013, issue ? ... 2012, issue ? ... 2011, issue ? ... 2010, issue ? ... 2009, issue ? ... 2008, issue ? ... Web-site of Russian Journal of Biological Invasions is developed and supported by the . Group of Bioinformatics and Modeling Biological Processes" IPEE RAS . ... Russian Journal of Biological Invasions . ...

Еще в разделе: (Показать все результаты (>2737) - www.sevin.ru/ )

• Russian journal of biological invasions: Contents
• Russian Journal of Biological Invasions: 2012, issue ? 4
• Russian Journal of Biological Invasions: 2012, issue ? 3

... MPI_Attr_delete . Deletes attribute value associated with a key #include "mpi.h" int MPI_Attr_delete ( comm, keyval ) MPI_Comm comm; int keyval; . ... All MPI routines (except MPI_Wtime and MPI_Wtick ) return an error value; C routines as the value of the function and Fortran routines in the last argument. ... The error handler may be changed with MPI_Errhandler_set ; the predefined error handler MPI_ERRORS_RETURN may be used to cause error values to be returned. ... MPI_ERR_COMM . ... Центры . ...

Еще в разделе: (Показать все результаты (>440) - www.parallel.ru/ )

• MPI_Keyval_free | PARALLEL.RU - Информационно-аналитический центр по
• Introduction | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Window Creation | PARALLEL.RU - Информационно-аналитический центр по

install ]] . ... Installation of a user directory . ... Below, we use the following notations: XXXX - CompHEP version number; comphep-XXXX - directory where CompHEP files will live; comphep-XXXX.tgz - distributive tar-file with sources; comphep-XXXX-linux.tgz - distributive tar-file with binaries; . ... The directory with name comphep-XXXX will be created with all files of CompHEP distributive. ... In order to create a user working directory execute: make setup WDIR=path_to_user_work_directory . ...

Еще в разделе: (Показать все результаты (>87) - comphep.sinp.msu.ru/ )

An annotated checklist of the insectivores (Mammalia, Lipotyphla) of Vietnam . Abramov A.V., Dang Ngoc Can, Bui Tuan Hai Nguyen Truong Son . P. 57-70 . An annotated checklist of 32 extant species from 12 genera of the insectivores (Mammalia, Lipotyphla) of Vietnam is provided. ...

Еще в разделе: (Показать все результаты (>712) - zmmu.msu.ru/ )

• Russian Journal of Theriology

... Each day a different image or photograph of our fascinating universe is featured, along with a brief explanation written by a professional astronomer. November 11, 1997 . The Annotated Galactic Center . ... Constellations of nearby stars include Sagittarius , Libra , Scorpius , Scutum , and Ophiuchus . ... Open clusters include M6 , M7 , M18 , M21 , M23 , M24 , M25 . Globular clusters include M9 , M22 , M28 , M54 , M69 , M70 . ... About APOD > . ... NASA Technical Rep.: ...

Еще в разделе: (Показать все результаты (>5) - www.arcetri.astro.it/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom2_2013.pdf

... public class Attribute . ... They have a name, type and an array of values. ... Attribute (java.lang.String name, double value) . ... If the value represents an array type, returns the Class object representing the component type of the array; otherwise returns null. int . ... Constructor Detail public Attribute (java.lang.String name, java.lang.Number value) . ... public Attribute (java.lang.String name, double value) . ... public Attribute (java.lang.String name, java.lang.Object theValue) . ...

Еще в разделе: (Показать все результаты (>52) - angel.cs.msu.su/ )

• : Package ucar.netcdf
• : Interface AttributeSet
• : Class ProtoVariable

... Search for Single Top Quark Production at DZero using Neural Networks" . ... Search for Single Top Quark Production at D0 Using Neural Networks" . ... Search for Electroweak Production of Single Top Quarks" . ... Use of Neural Networks in a Search for Single Top Quark Production at D0", . ... Search for Single Top Quark Production at the Tevatron" . ... Use of Neural Networks in a Search for Single Top Quark Production with the DZero Detector at the Fermilab Tevatron Collider", . ...

Еще в разделе: (Показать все результаты (>3) - top.sinp.msu.ru/ )

... We have recently provided detailed insight into structural aspects and chemical behaviour of several alkali-metal acylpyrazolonato systems. Here we extend our study on the interaction of these donors toward zinc(II) and cadmium(II) acceptors in the presence of several mono- and bidentate ancillary ligands. Hydrated or solvated bis(acylpyrazolonate)metal derivatives can be readily obtained, which are stabilized in the solid state by extensive intermolecular H-bonding. ...

Еще в разделе: (Показать все результаты (>117) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 47, No. 1, P. 20 (2006)

... Many protein families contain homologous proteins that have a common biological function but different specificity. Given a multiple sequence alignment of a family divided into specificity groups, SDPpred predicts a set of alignment positions ( SDP, Specificity-Determining Positions ) that determine differences in the functional specificity. ... 2004) Automated selection of positions determining functional specificity of proteins by comparative analysis of orthologous groups in protein families. ...

Еще в разделе: (Показать все результаты (>15) - bioinf.fbb.msu.ru/ )

• RNA Alignment
• SDPlight
• Site Cluster

... Siberian Lang . Minority languages of Siberia as our cultural heritage . ... The project ?Development of the web-site ?Minority languages of Siberia as our cultural heritage? (on the material of the languages of the basin Middle Yenisei and the Middle and the Upper Taz)? was realized at the Laboratory for Computational Lexicography, Research Computing Centre, Lomonosov Moscow State University, with financial support from Russian Foundation for the Humanities, grant 12-04-12049.љ ...

39. Academic Life

40. Intelligent Systems :: Research :: :: Articles