... Class . ... java.lang.Object java.awt.Component java.awt.Container java.awt.Window java.awt.Frame javax.swing.JFrame methods.SpectrumDataViewerFrame . ... Nested classes inherited from class javax.swing.JFrame . ... Nested classes inherited from class java.awt.Frame . ... Nested classes inherited from class java.awt.Window . ... Nested classes inherited from class java.awt.Container . ... Nested classes inherited from class java.awt.Component . ... package private) java.io.File . ... private void . ...

Еще в разделе: (Показать все результаты (>145) - angel.cs.msu.su/ )

• TimeProcessDataViewerFrame
• BarChart
• DesktopManager.TypeAndTitleForm

MGU Botanic Garden . ... MSU Botanical gardens branch 'Pharmaceutical garden' . ... Metro station Universitet , buses: 1, 113, 661, descend at the 'DK MSU' stop, buses 119, 67, 103, 130, 187, 260, trolleybus 34, descend at the stop 'Mendeelskaya st.'. 15-20 min from the metro station to the gates of the Garden. Metro st 'Kievskaya', bus 119, descend at the stop 'Mendeevskaya st', 30 min from the metro station to the gates of the Garden . ... MSU Botanical Garden: 'Pharmaceutical Garden' branch:: . ...

Еще в разделе: (Показать все результаты (>4) - botsad.msu.ru/ )

. AUTHOR : Maksimov A. 1.     Nonlinear Transient Bubble Oscillations . A.Maksimov, E.V.Sosedko   (Il'ichev Pacific Oceanological Institute, Far East Branch of Russian Academy of Sciences, Vladivostok, Russia); T.G.Leighton (Institute of Sound and Vibration Research, University of Southampton, Highfield, Southampton, United Kingdom) . 2.     Symmetry in Bubble Dynamics . A.O.Maksimov (V.I. Il'ichev Pacific Oceanological Institute Far East Branch, Russian Academy of Sciences, Vladivostok, Russia) .

Еще в разделе: (Показать все результаты (>48) - acs366.phys.msu.su/ )

• Abstract (Invited)
• Abstract

The most up-to-date information related to atmos 3.0 are collected here due to constantly increasing interest to MASS/DIMM processing software... atmos 3.0 is still beta , so the latest version is 2.97.5 (there is also 2.98.x branch which absorbs new features) . ... M' line: . ... free seeing and its relative error . ... dimm seeing and its relative error (if dimm data are present, zeros otherwise) . ... dimm turbulence power and its relative error (if dimm data are present, zeros otherwise) . ...

Еще в разделе: (Показать все результаты (>17) - curl.sai.msu.ru/ )

... These spectral characteristics compare with introduction (ВВЕДЕНИЕ) At last time many workers have studied thermal Rayleigh-Benard convection using numerical At last time many workers have studied thermal Rayleigh- Benard convection using numerical time many At last time many workers have studied thermal Rayleigh-Benard convection using numerical used spectral methods with periodic boundary conditions. ... In numerical simulations were derived secondary stationary, [pic] where ? ...

Еще в разделе: (Показать все результаты (>8) - hit-conf.imec.msu.ru/ )

... P ast C S et. e C P aste = {e C : e e} н , e, e1 e2 P aste1 e2 : P aste1 P aste2 , . P ast [2] . ... S etC . ... Loc P ast [2] . ... 13): (мLo c)e = {w W : e , (мLo c = ) (e C w W P aste w = ). 3.2. мLo c . ... Glob (4) [Loc ] : Glob , [Loc ]e (w) = df [F ] (30) (31) {(e e) M orC (§, e) : e w}. e, , , e , , w. e w, (31) e н , P aste w = , (31) () н . ... e e0 {(e e) M orC (§, e) : Lo ce Lo ce0 = }. 8 (33) (32) Loc Lo ce0 , Lo ce0 : [Lo ce0 ]e = Lo ce0 e. , e0 e, (33) e. , (33) , P aste e0 . ...

Еще в разделе: (Показать все результаты (>89) - chronos.msu.ru/ )

• Ильичев Л. В. (Il'ichov L. V.)

Modules | Directives | ... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Modules . ... Description: . Content cache storage manager keyed to URIs . ... Experimental . ... disk_cache_module . ... This module is experimental. Documentation is still under development... mod_disk_cache implements a disk based storage manager. ... If the mod_disk_cache module has been loaded or compiled in to the Apache server, this directive must be defined. ...

Еще в разделе: (Показать все результаты (>144) - itpm.msu.su/ )

• Overview of the Directory Tree
• The if and goto Commands
• Ethernet Cabling

ICASS VI Programme Session 06.02: World history of the last century reflected in life stories of autochthonous minorities in the North 23.08.2008 Chair: Kazakevich, Olga; Lomonosov Moscow State University; Russia Co-Chair: Burkova, Svetlana; Institute of Philology, Russian Academy of Sciences, Siberian branch; Russia 1. ... Koshkareva, Natalya; Institute of Philology, Russian Academy of Sciences, Siberian Branch; Russia 3. Changes in Russia in 1920-50s through Forest Nenets Life Stories . ...

Еще в разделе: (Показать все результаты (>5) - lcl.srcc.msu.ru/ )

• ЛАБОРАТОРИЯ АВТОМАТИЗИРОВАННЫХ

... About lab . ... MSU Graphics & Media Lab (Video Group) . The filter is intended for recovering visual quality of video ripped from DVD (for example, when it contains 4 hours of video data), VideoCD or after decompressing by H.261, H.263, H.264, DivX, XviD, etc. The algorithm decreases blocking artifacts, significantly improving visual quality of video. Filter automatically determines the blockiness's strength on the frame and in the certain part of it, preserving the maximum of details. ...

Еще в разделе: (Показать все результаты (>61) - graphics.cs.msu.ru/ )

• Removing of blocking effect from video | Лаборатория компьютерной графики и
• GML AdaBoost Matlab Toolbox | Лаборатория компьютерной графики и мультимедиа
• GML LidarK Library | Graphics and Media Lab

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>16) - bioinf.fbb.msu.ru/ )

• SDPpred
• RNA Alignment
• SDPlight

... Conference Venue . ... Kirk Hatfield University of Florida, Department of Civil and Coastal Engineering, Gainesville, USA . ... Irina V. Perminova Co-Chair of Organizing Committee, Department of Chemistry, Lomonosov MSU, coordinator of the CIS IHSS chapter . ... Olga Yakimenko Conference Secretary, Department of Soil Science, Lomonosov MSU . ...

Еще в разделе: (Показать все результаты (>35) - mgumus.chem.msu.ru/ )

RIDGE AND TREE FEATURE DETECTION ON IMAGES A. Levashov 2, D. Yurin3 2, 3 1 Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Leninskie Gory, Moscow 119991, Russia 2 alexeylevashov89@gmail.com , 3yurin@cs.msu.ru In this article a new ridge detector with improved non-maxima suppression procedure in scale-space is proposed. ... The algorithm is tested on synthetic, landscape and medical images. ...

Еще в разделе: (Показать все результаты (>3) - imaging.cs.msu.ru/ )

... Land Hydrology . ... Recreational Geography and International Tourism . ... Economic and Social Geography of Russia . ... Departments . ... Main accomplished research: River hydrology, limnology, hydrometry, water quality, flow hydraulics, hydrological predictions, fluvial processes, hydrophysics, hydrogeology, water management, water ecology. ... Large international conferences were organized by Hydrology Department for the last years – for example X Symposium on River Sedimentation (2007). ...

Еще в разделе: (Показать все результаты (>110) - eng.geogr.msu.ru/ )

• Administration
• Complex Mapping
• Educational council

... A history of creation and development of scientific direction "Immobilized Enzymes" in Russia and the international conference "Biocatalysis. ... Also reflects the stages of creation and development of national and then international scientific conference "Biocatalysis. ... Moscow University Chemistry Bulletin . 2014, Vol. ... Copyright (C) Chemistry Dept., Moscow State University, 2002 . ... Copyright (C) Chemisty Department of Moscow State University . ...

Еще в разделе: (Показать все результаты (>60) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 55, No. 6, P. 315 (2014)
• Nikolai M. Emanuel
• Long Range Molecular Correlations and Hydrogen Bonding in Liquid Methanol

ARM . 12: · ARM 2 ARM Powered Products 3 ARM · 4 · ARM 32- . ARM : ­ Byte - 8 bits ­ Halfword - 16 bits ( ) ­ Word - 32 bits ( ) · ARM ­ 32-bit ARM Instruction Set ­ 16-bit Thumb Instruction Set 5 · ARM : ­ User : , ­ FIQ : , high priority (fast) ­ IRQ : , low priority (normal) ­ Supervisor : Software Interrupt instruction ­ Abort : ­ Undef : ­ System : , 6 User ARM Current Visible Registers Abo Und rtMod SVCMode IRQ ef Mode FIQ Mode e User ...

Еще в разделе: (Показать все результаты (>3) - lvk.cs.msu.su/ )

... Terskite, Na 4 ZrSi 6 O 16 ? ... Na can be easily exchanged to K, Rb, Cs, Ca, Sr, Ba or Pb in solutions of their salts even under room conditions (Grigorieva et al ., ... Several series of experiments were performed: for twenty-four hours under room temperature and for three hours under 90 and 120њC . ... Degree of exchange of Na to Cs decreases twice with the temperature increase: 4.1% Cs 2 O was recorded in the samples after experiments under 120 C while up to 9.8 % - under the room temperature. ...

Еще в разделе: (Показать все результаты (>84) - geo.web.ru/ )

• http://geo.web.ru/conf/khitariada/1-2003/informbul-1_2003/magm-8e.pdf
• http://geo.web.ru/conf/alkaline/2009/Prikhodko.htm
• http://geo.web.ru/conf/alkaline/2009/Chernyshova.htm

. Links . arXiv.org (Lanl gov) . Large amount of articles . http://arXiv.org . Scientific Electronic Library . http://www.elibrary.ru . Elsevier Science; Kluwer Academic Publishers; Springer Berlin Heidelberg . and others... Laboratory of Theoretical Nonlinear Dynamics in Institute of Radio-Engineering and Electronics of RAS, Saratov Branch IRE RAS . http://www.sgtnd.tserv.ru . Head of the group Doctor of Sciences, Professor Sergey P. Kuznetsov . Painter Andrey Isaev . http://www.IsaevArt.ru .

Еще в разделе: (Показать все результаты (>23) - chaos.phys.msu.ru/ )

... About choir . ... Performance the Academic Choir of the Moscow State University in Crocus City Hall . ... Bishop Tikhon opened the choir of Moscow State University in Vienna . Choir of Moscow State University spoke at the Vienna branch of the United Nations . ... Oldest amateur choir in Russia . Moscow state university Academic choirљ . ... Any questionsљby phone:љ+7 (495) 939-1862, +7 (495) 939-3563 . ...

40. The case statement