. GMAIL .

Еще в разделе: (Показать все результаты (>2) - astrometric.sai.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

BOOKMARK [0][-]{chapter*.2}{Foreword}{}% 1 \ BOOKMARK [0][-]{chapter*.3}{Glossary}{}% 2 \ BOOKMARK [0][-]{chapter.1}{Introduction to the Introduction}{}% 3 \ BOOKMARK [1][-]{section.1.1}{ Plants , Botany, and Kingdoms}{chapter.1}% 4 \ BOOKMARK [2][-]{subsection.1.1.1}{Taxonomy}{section.1.1}% 5 \ BOOKMARK [2][-]{subsection.1.1.2}{Methods of Taxonomy and Diagnostics}{section.1.1}% 6 \ BOOKMARK [1][-]{section.1.2}{Styles of ...

Еще в разделе: (Показать все результаты (>19) - herba.msu.ru/ )

• http://herba.msu.ru/shipunov/school/biol_240/en/visual_statistics.out

Given word length and max number of mismatches . Use MEME algorithm for define conserved blocks . Apply the Dynamic programming algorithm to create chain of the blocks . Refine the chain using combined profile for chain of blocks. ... Reduce word length and number of mismatches and repeat the procedure for spacer between the blocks. ... Create helix profile and apply MEME-like iterative procedure to find sets of helices that consistent lokated reative to conserved blocks . ...

Еще в разделе: (Показать все результаты (>15) - bioinf.fbb.msu.ru/ )

• SDPlight
• Alignment example
• SDPpred

... The safest is to let URLPARAM encode the unsafe characters (default) but this prevents the user from entering Foswiki macros in the comment input fields. ... Generic prompt box used by other templates % TMPL : DEF {promptbox}% div class= commentPlugin commentPluginPromptBox table border= 0 cellpadding= 0 ... valign= middle td textarea %DISABLED% rows= %rows|3% cols= %cols|70% name= comment class= foswikiInputField onfocus= if(this.value=='%MESSAGE%')this.value='' onblur= if(this.value ...

Еще в разделе: (Показать все результаты (>1975) - wiki.cmc.msu.ru/ )

1) Faculty of Soil Science, Moscow State University, Moscow 119899, Russia; . ... We assessed critical loads of acid deposition and their exceedance for soils in the Kola Peninsula using a simple balance method and mapped them within 1.0° · 0.5° longitude/latitude grid cells. ... Terrestrial ecosystems in the north-western Kola Peninsula are particularly susceptible to acid deposition damage due to relatively high soil sensitivity and heavy sulphur deposition. back . ...

Еще в разделе: (Показать все результаты (>27) - eco.soil.msu.ru/ )

• EFFECTS OF ACID DEPOSITION ON ACIDITY IN PODZOLS
• CRITICAL LOADS OF ACID DEPOSITION IN EUROPEAN RUSSIA
• SIMULATION OF ACID SNOW AND RAIN IMPACT ON FORESTS

The QGroupBox widget provides a group box frame with a title. ... QGroupBox  ( QWidget * parent=0, const char * name=0 )  . QGroupBox  ( const char * title, QWidget * parent=0, const char * name=0 )  . const char*  title  () const . ... int  alignment  () const . ... Constructs a group box widget with no title. ... Constructs a group box with a title. ... Returns the alignment of the group box title. ... Sets the alignment of the group box title. ... Sets the group box title text to title. ...

Еще в разделе: (Показать все результаты (>42) - rtm-cs.sinp.msu.ru/ )

• Qt Reference Documentation
• Qt Toolkit - QBoxLayout Class
• Qt Documentation

... О UNИX . ... HelpOnImages . Неизменяемая страница . ... Working With Images . ... If you just want to get an image on a page, simply upload the image file (using the 'Attachments' link). ... For example, if you put large image {{attachment:duckie.png}} into the middle of a paragraph, like this , then that's exactly what you'll get. ... This example uses a chair image that's aligned left. Notice that paragraph text flows around it, so you can (for example) stagger images on the page. ...

Еще в разделе: (Показать все результаты (>24) - uneex.mithril.cs.msu.su/ )

• HelpOnTables - UNИX
• WikiCourse/15 Tables - UNИX

... О UNИX . ... HelpOnImages . Неизменяемая страница . ... Working With Images . ... If you just want to get an image on a page, simply upload the image file (using the 'Attachments' link). ... For example, if you put large image {{attachment:duckie.png}} into the middle of a paragraph, like this , then that's exactly what you'll get. ... This example uses a chair image that's aligned left. Notice that paragraph text flows around it, so you can (for example) stagger images on the page. ...

Еще в разделе: (Показать все результаты (>44) - uneex.lorien.cs.msu.su/ )

• HelpOnTables - UNИX
• Online Unix References and Tutorials
• WikiCourse/15 Tables - UNИX

... G. K. Zhavnerko, V. N. Staroverov, V. E. Agabekov, M. O. Gallyamov, I. V. Yaminsky . ... Atomic force microscopy, ellipsometry, and piezoquartz microweighing techniques were used to study the characteristic of N-octadecyl-3,4:9,10-perylene-bis(dicarboxydiimide) monomolecular layers... <more> . ... The influence of the chemical structure of film-forming material, the pressure of deposition, and the nature of substrate upon the film morphology has been studied by atomic force microscopy... <more> . ...

Еще в разделе: (Показать все результаты (>4) - www.spm.genebee.msu.ru/ )

Alignment in free decaying MHD turbulence" . ... Using a shell model of turbulence, we have investigated a long-time evolution of magnetic and velocity fields in the MHD turbulence with various types of initial states. ... For most realizations, a coherent state with high alignment between the magnetic and velocity fields has been developed. In the case of establishment of the coherent state, the dissipation rate of energy is found to be substantially reduced. ...

Еще в разделе: (Показать все результаты (>2) - num-meth.srcc.msu.ru/ )

... 32Bits Online: because there's more than one way to compute . New about new versions of computer related stuff . AAA Matilda Web Search . ... Search . ... The Music Database . ... Musicians looking for other musicians (Free Service) . ... The Mac Game Database uses PHP and MySQL . ... Bioinformatics databases at the Montreal Children's Hospital using MySQL . ... DSL providers search with reviews Made with MySQL and Modperl, all pages are generated dynamically out of the MySQL database . ...

Еще в разделе: (Показать все результаты (>25) - itpm.msu.su/ )

• Alignment, font styles, and horizontal rules in HTML documents

Annotation of the graduate work of 6th-year student I.V. Yakimchuk Study of the Whispering Gallery Effect at a Spherical Surface in Hard X-Ray Region Whispering gallery (WhG) effect consists in that an x-ray/soft x-ray bea m falling tangentially onto a concave surface slides along it due to successive total external reflections. ... Ray-tracing computer code is used to analyze experimental data. Results of measurements and computer simulations are demonstrated to be in an excellent agreement. ...

Еще в разделе: (Показать все результаты (>39) - ofvp.phys.msu.ru/ )

• Grant detail

Key-words: rhythm, stress, syllable, rhythmic structure, syntagm, utterance, prosody, speech production, speech perception . ... In speech communication, RS are both units of speech production and speech perception. ... The research of speech rhythm in diachrony and synchrony consists of the analysis and the description of speech rhythmic units concerning Old Church Slavonic, Old Russian, Old High German in diachrony and Modern Russian, German, Czech and Bulgarian in synchrony. ...

Еще в разделе: (Показать все результаты (>44) - www.philol.msu.ru/ )

• LangueDOC :: Tools :: Text conversions

... Siberian Lang . Minority languages of Siberia as our cultural heritage . ... The project ?Development of the web-site ?Minority languages of Siberia as our cultural heritage? (on the material of the languages of the basin Middle Yenisei and the Middle and the Upper Taz)? was realized at the Laboratory for Computational Lexicography, Research Computing Centre, Lomonosov Moscow State University, with financial support from Russian Foundation for the Humanities, grant 12-04-12049.љ ...

36. http://kodomo.cmm.msu.su/trac/snake/log/?format=changelog&rev=6cdd9eb62aa06498e53a099723278b3936d14b7f&limit=100&mode=stop_on_copy

37. Supernova 1999gp in UGC 1993

38. http://temporology.bio.msu.ru/RREPORTS/sochivko_psihodinamika-anekdot.pdf

39. Nurtdinov R.N. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

40. ApSA courses