head1 NAME . CGI::Session::Serialize::json - serializer for CGI::Session . ... This library can be used by CGI::Session to serialize session data. ... JSON is a type of L<YAML|CGI::Session::Serialize::yaml>, with one extension: serialized JSON strings are actually valid JavaScript code that a browser can execute. Any langauge that has a YAML parser (Perl, PHP, Python, Ruby, C, etc) can also read data that has been serialized with JSON. =head1 METHODS . ... L<CGI::Session>, L<JSON::Syck>. ...

Еще в разделе: (Показать все результаты (>31063) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% (1 vs. 2) - TWiki
• %TOPICTITLE% (3 vs. 4) - TWiki
• IfStatements - TWiki - TWiki - (printable)

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>251) - monkey.belozersky.msu.ru/ )

• HTH3_numeration_assumed
• ETS_all_contacts alignment
• Inquiry information || Formats of alignments

... NASA ADS . ... Astronet . ... Sergei Popov's Bookmarks . ... Russian Academy of Sciences . SETI-site of the Stenberg Astronomical Institute . ... Shvartsman V.F. Gurevich I.M. Panov A.D. Movie Database . ... Subtitles 1 . ... Writers Guild of America . ... Ancient Rome . ...

Еще в разделе: (Показать все результаты (>67) - lnfm1.sai.msu.ru/ )

• Bookmarks for Andrew I. Zakharov
• Bookmark

... Thus, the development of a method of synthesis of signals of finite duration, optimal in the sense of maximum concentration of energy in specified frequency ranges, is the actual problem. ... Erik Larsen, Ronald M. Aarts, "Audio Bandwidth Extension: Application of Psychoacoustics, Signal Processing and Loudspeaker Design", John Wiley & Sons, ISBN: 0-470-85864-8, September 2004. ... Time-frequency decomposition, 2. ... Shaping of the energy spectrum envelope of high-frequency content, 4. ...

Еще в разделе: (Показать все результаты (>86) - imaging.cmc.msu.ru/ )

RUSSIAN PEREPLET . Culture, Science, and Education Portal . Science Space Culture General Discussion Scientific Discussion Seminars . News: The best of Russian Science and Technology . ... MASTER Team Science Release: Discovery of the Black Hole Ergosphere? ... The International Conference "The International Conference" . ... MASTER is the first russian asteroid factory . ... New Russian "Volga" . ... MASTER - is the first russian robotic telescope for observations Gamma-Ray Bursts . ...

Еще в разделе: (Показать все результаты (>152) - www.pereplet.ru/ )

... Finance - Currency Conversion . FXConverter - OANDA's 164 Currency Converter . ... PNAS Online -- Search Multiple Journals . ... Scirus - For Scientific Information Only . Molecular Biology Software . Education and Genetics: Human Genome Project Information . Journal of Computational Biology Table of Contents . LINK Alert Service - Subscribe . Springer LINK - Forum for Science . ... Genome Biol Vol. ... COMPUTATIONAL BIOLOGY . ... Journal Impact Factor 2000 . ...

Еще в разделе: (Показать все результаты (>59) - higeom.math.msu.su/ )

. GMAIL .

Еще в разделе: (Показать все результаты (>4) - astrometric.sai.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

BOOKMARK [0][-]{chapter*.2}{Foreword}{}% 1 \ BOOKMARK [0][-]{chapter*.3}{Glossary}{}% 2 \ BOOKMARK [0][-]{chapter.1}{Introduction to the Introduction}{}% 3 \ BOOKMARK [1][-]{section.1.1}{ Plants , Botany, and Kingdoms}{chapter.1}% 4 \ BOOKMARK [2][-]{subsection.1.1.1}{Taxonomy}{section.1.1}% 5 \ BOOKMARK [2][-]{subsection.1.1.2}{Methods of Taxonomy and Diagnostics}{section.1.1}% 6 \ BOOKMARK [1][-]{section.1.2}{Styles of ...

Еще в разделе: (Показать все результаты (>48) - herba.msu.ru/ )

• http://herba.msu.ru/shipunov/school/biol_240/en/visual_statistics.out
• Materials of A. Shipunov

# # ChangeLog for / # # Generated by Trac 0.12.5 # 04/11/16 22:35:03 Sun, 19 Dec 2010 23:26:49 GMT Alex Martynov [98:4436cf8ba30c] * main.py (modified) * main.py (modified) merge Sun, 19 Dec 2010 23:26:31 GMT Alex Martynov [97:c89777ba44ec] * main.py (modified) main.UI.dead_snakes_check() Sun, 19 Dec 2010 23:26:35 GMT Danya Alexeyevsky <me.dendik@тАж> [96:3619305694ad] * main.py (modified) Actually fixed buttons resizing. Fixed code separation for buttons ...

Еще в разделе: (Показать все результаты (>847) - kodomo.cmm.msu.su/ )

• http://kodomo.cmm.msu.su/trac/snake/log/?format=changelog&rev=4436cf8ba30c3522ccc594ae40eb8ef475ddd065&stop_rev=96%3A3619305694ad&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/snake/log/?format=changelog&rev=4436cf8ba30c3522ccc594ae40eb8ef475ddd065&stop_rev=3619305694ad0e54c71cfdd53f477ce8f80ba962&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/snake/log/?format=changelog&rev=171%3A6cdd9eb62aa0&limit=100&mode=stop_on_copy

... METHOD . ... public interface IndexMap . ... The int [] transform(int [] output, int [] input) does this. ... The transformation of values in the input array is obtained by calling int [] getTransformed(int [] output) . ... int[] . ... input - int array domain reference member. public int[] getTransformed (int[] output) . ... public int[] transform (int[] output, int[] input) . ... lengths - int array representing the shape on the forward transform output. public int[] getLengths (int[] output) . ...

Еще в разделе: (Показать все результаты (>69) - angel.cs.msu.su/ )

• ExtensionFileFilter
• Serialized Form

. Faculty of Mechanics and Mathematics, . M.V. Lomonosov Moscow State University . This site is created and supported by . the A.M. Liapunov French-Russian Institute . of Moscow State University .

Еще в разделе: (Показать все результаты (>13) - new.math.msu.su/ )

Given word length and max number of mismatches . Use MEME algorithm for define conserved blocks . Apply the Dynamic programming algorithm to create chain of the blocks . Refine the chain using combined profile for chain of blocks. ... Reduce word length and number of mismatches and repeat the procedure for spacer between the blocks. ... Create helix profile and apply MEME-like iterative procedure to find sets of helices that consistent lokated reative to conserved blocks . ...

Еще в разделе: (Показать все результаты (>15) - bioinf.fbb.msu.ru/ )

• Alignment example
• SDPpred
• Site Cluster

... The legs didn?t ride up high, plenty of shorts get. ... Mixing and matching layers and turning shirts into dresses have the ability to belts are not the same ways things whole new outfits, . ... 7) Turn the radio off. Unless you?re scoping out the sound system, leave the radio off. Is actually why so frequency higher any unusual noises. Maybe even turn the A/C on and off and search for noises there as excellent. ...

Еще в разделе: (Показать все результаты (>39) - elana.sinp.msu.ru/ )

• editor | С Днем Победы!
• moncler outlet uk An insider secret to the Pre Draft combines that not a lot of

ChartPlugin Tests with Remote Data This topic just contains two tables which are referenced from the ChartPluginTests topic. To distinguish the data on this page from other data, the *actual* values have been increased by 0.51 and 0.52 to denote table 1 and table 2 respectively. ... 100 | ... Remote:Actual Value* | ... Test:Averages* | CALC{"$EVAL($SUM(xR3:C2.. ... This topic: System > ChartPlugin > ChartPluginTests > ChartPluginTestsRemote . ... Ideas, requests, problems regarding Foswiki? ...

Еще в разделе: (Показать все результаты (>5020) - wiki.cmc.msu.ru/ )

• CommentPluginTemplate < System < Foswiki
• HttpsRedirectPlugin < System < Foswiki
• SystemRequirements < System < Foswiki

Faculty of Physics of Lomonosov Moscow State University . ... Department of Photonics and Microwave Physics is one of the largest departments of Faculty of Physics of Lomonosov Moscow State University . ... Our department holds annual conference on wave phenomena in nonhomogeneous media, physics and applications of microwaves in May in Moscow suburb. ... Physics of microwaves . ... Department of Photonics and Microwave Physics . Faculty of Physics . Lomonosov Moscow State University . ...

37. Unplugged in Charlottesville (1995)

38. FFTW - Footnotes | PARALLEL.RU - Информационно-аналитический центр по

39. Audio Bandwidth Extension using Cluster Weighted Modeling of Spectral Envelopes

40. HelpOnImages - UNИX