... 2, Moscow 123182, Russia Sergey V. Razin Institute of Gene Biology, RAS, Vavilova st. 34/5, Moscow 119334, Russia sergey.v.razin@usa.net In Drosophila, interphase chromosomes are organized in topologically associated domains (TADs) within which chromatin-chromatin interactions are frequent, while interactions across domain borders are rare [1]. ... Here we used Hi-C method [5] to map TADs in four drosophila cell lines of different origin. ... Cell 48:471­84. ...

Еще в разделе: (Показать все результаты (>273) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/45.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/55.pdf
• MCCMB'15

... Each day a different image or photograph of our fascinating universe is featured, along with a brief explanation written by a professional astronomer. June 16, 1998 . An Active Region of the Sun . Credit: A. Title ( Stanford Lockheed Institute ), TRACE , NASA . ... This false-color image depicts an active region near an edge of the Sun . Hot plasma is seen exploding off the Sun's photosphere and traveling along loops defined by the Sun's magnetic field . ... About APOD > . ...

Еще в разделе: (Показать все результаты (>132) - www.arcetri.astro.it/ )

• APOD: August 7, 1998 - M65 Without Moth
• APOD: May 22, 1996 - Star Cluster in the Rosette Nebula

makecpt - Make GMT color palette tables makecpt [ -C table ] [ -I ] [ -T z0 / z1 / dz ] [ -V ] [ -Z ] makecpt is a utility that will help you make color palette tables (cpt files). ... The resulting cpt file can be reversed relative to the master cpt, and can be made continuous or discrete. ... Choose among the built-in tables (type makecpt to see the list) or give the name of an existing cptfile [Default gives a rainbow cpt file]. I Reverses the sense of color progression in the master cptfile. ...

Еще в разделе: (Показать все результаты (>443) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~ivan/gmt/man/psscale.html
• http://xray.sai.msu.ru/~ivan/gmt/man/grdmask.html
• http://xray.sai.msu.ru/~leng/diskusage/new/

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Узнать цвет пикселя. Работа с видеопамятью. С/С++ [ + OpenGL ? ... На входе координаты пикселя, на выходе например (255, 0, 0 ) если красный. ... OpenGL тебе не поможет. ...

Еще в разделе: (Показать все результаты (>3141) - www.snto-msu.net/ )

• vote is not defined - Public forum of MSU united student networks
• Массив констант и директива #define. - Public forum of MSU united student
• In case of loss, please return to: - Public forum of MSU united student...

... Please retype /font /b /td /tr % } tr td class = form nbsp; b Your name: /b /td td class =formi input type=text size= 60 value= %$ author % name= author /td /tr tr td class = form nbsp; b Your e-Mail: /b /td td class =formi input type=text size= 60 value= %$ dbh->quote($author) . ... br>"); return -1; } my $last_id=DB_functions::get_max_id($dbh,$tree,'id'); my $parent = ($id>0)?$id:0; if (!$dbh->do("INSERT INTO $tree (id,parent,resource) VALUES ( $last_id," . ...

Еще в разделе: (Показать все результаты (>77) - www.kosmofizika.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>191) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• GeneBee BLAST 2.2.8 Services Help
• GeneBee BLAST 2.2.22+ Services Help

... Groups . Wiki Groups . ... Other ways to define groups / access group definitions A group is a simple data structure that maps a group name to a set of group member names. ... E.g. on a group definition page AdminGroup : #acl AdminGroup:read,write,revert All:read #format wiki Members of this group will get admin rights. ... As you see: only members of this group may write to the group definition page (and of course everyone who gets write rights from acl_rights_before in the wiki config). ...

Еще в разделе: (Показать все результаты (>467) - uneex.lorien.cs.msu.su/ )

• Text Menu
• rpmrc File Entries
• Inside the Spec File

... Groups . Wiki Groups . ... Other ways to define groups / access group definitions A group is a simple data structure that maps a group name to a set of group member names. ... E.g. on a group definition page AdminGroup : #acl AdminGroup:read,write,revert All:read #format wiki Members of this group will get admin rights. ... As you see: only members of this group may write to the group definition page (and of course everyone who gets write rights from acl_rights_before in the wiki config). ...

Еще в разделе: (Показать все результаты (>163) - uneex.mithril.cs.msu.su/ )

• HelpOnSlideShows - UNИX
• HelpOnDictionaries - UNИX
• HelpOnSynchronisation - UNИX

О лаборатории . ... Лаборатория теоретической биофизики . ... System requirements : python 2 (2.6 and higher), python openbabel library, python numpy library. ... The memgen script makes a bilayer membrane from different phospholipids and other lipid compounds (e.g. cholesterol). ... Biochemistry (Moscow) Supplement Series A: Membrane and Cell Biology, 2011, Vol. ... Нет комментариев " Python membrane generator for MD simulations " . ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>59) - erg.biophys.msu.ru/ )

• All-atom automatic OPLS-AA topology generator ERG Research Group: Лаборатория
• Peter Mamonov ERG Research Group: Лаборатория теоретической биофизики
• Building and plotting Fukui function with FireFly and PyMol ERG Research Group:

. 1. Move the cursor to the start of the text block you want to define. 2. Type M-space (the META character followed by a space). This sets a 'mark' at the start of the 'region'. 3. Move the cursor to the end of the text block you want to define as the 'region'. This sets the 'point' at the end of the 'region'. You do not have to type anything to set this 'point', the 'point' is the location of the cursor.

Еще в разделе: (Показать все результаты (>186) - comet.sai.msu.ru/ )

• Defining files with wildcard characters
• Defining the sort field
• Understanding HTML and MIME

... From the top-level of the Apache source tree, type: cd support [ENTER] . ... From support/suexec.h /* * HTTPD_USER -- Define as the username under which Apache normally * runs. ... See the suEXEC documentation for more detailed * information. */ #define USERDIR_SUFFIX "public_html" /* * LOG_EXEC -- Define this as a filename if you want all suEXEC * transactions and errors logged for auditing and * debugging purposes. */ #define LOG_EXEC "/usr/local/apache/logs/cgi.log" /* Need me? ...

Еще в разделе: (Показать все результаты (>89) - neptun.sai.msu.ru/ )

• International Customized Server Error Messages
• Apache Keep-Alive Support
• Apache module mod_setenvif

... Influence of the active environment on the mechanical stability and damageability of the surface firm body . ... The role of contact interactions and primary damage of a surface as defining condition of the beginning of destruction of a body is considered. ... Moscow University Chemistry Bulletin . 2012, Vol. ... Copyright (C) Chemistry Dept., Moscow State University, 2002 . ... Copyright (C) Chemisty Department of Moscow State University . ... Web-design: Copyright (C) MIG and VVM . ...

Еще в разделе: (Показать все результаты (>669) - chem.msu.ru/ )

• What Defines The Activation Energy of Electron Transfer: Reorganization Energy
• Moscow University Chemistry Bulletin Vol. 53, No. 2, P. 133 (2012)
• Moscow University Chemistry Bulletin Vol. 50, No. 5, P. 396 (2009)

ON THE ERROR ESTIMATE OF APPROXIMATION OF FUNCTIONS OF BOUNDED VARIATION BY SZASZ-MIRAKYAN OPERATORS Singh S. N. SKM University, Dumka at Jamtara College, Jamtara, Jharkhand-815351 (India). ... The Szasz-Mirakyan operator is defined as Sn(f, x) = f(k/n) pk(nx), where k=0 pk(nx) = e-nx(nx)k/k!, n N, xR0. ... Cheng, F., On the rate of convergence of the Szasz-Mirakyan operator for functions of bounded variation, J. Approximation Theory 40 (1984), 226-241. ...

Еще в разделе: (Показать все результаты (>216) - www.mce.biophys.msu.ru/ )

... Parsimony method . ... It is based on the following principle: the ancestral sequences (posed in nodes of a phylogenetic tree) should be such that the minimal required number of character replacements on the branches of the tree is less than for any other choice of sequences. ... If the preliminary character of the node is * , but the output character of its immediate ancestor is some letter (say, X ), and its set of possible characters contains X , then the output character of the node is also X . ...

Еще в разделе: (Показать все результаты (>5628) - monkey.belozersky.msu.ru/ )

• About this project

extra:model:main ]] . CompHEP . ... Please address any questions concerning models to their authors. Authors of a model keep all rights. Any CompHEP user may apply a model respecting conditions defined by the authors. ... Model ==== ** Model description ** * Name: modelname * Author: modelauthor * Short description: * Long description: see [[http://www.univ.com/author/auth|modelauthor]] * {{http://comphep.sinp.msu.ru/extra/model/auth.zip|auth.zip}}, 123KB * References: - ref 1 - ref 2 .. ...

Еще в разделе: (Показать все результаты (>21) - comphep.sinp.msu.ru/ )

• install [CompHEP]
• extra:main [CompHEP]

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Unknown (undefined) flying bugs . ... Re: Unknown (undefined) flying bugs [ re: kaiafa ] . ... Re: Unknown (undefined) flying bugs [ re: exuperantia ] . ...

Еще в разделе: (Показать все результаты (>4814) - www.fds-net.ru/ )

• Объясните, пожалуйста, сакральный смысл #define - Public forum of MSU united
• vote is not defined - Public forum of MSU united student networks
• Помогите на бухло! please...(внутри фото) - Public forum of MSU united student

All Windows PC GAMESS/Firefly versions are parallel but can work in serial (sequential) mode. ... This library defines a particular implementation of MPI the PC GAMESS will use. At present, there are the following dlls available in the BINDINGS folder of PC GAMESS/Firefly installation directory: . ... The recommended MPI implementation for PC GAMESS/Firefly running in parallel on self-made (non CCS-based) Windows clusters is NT-MPICH. ... Parallel Windows Instructions: NT-MPICH . ...

Еще в разделе: (Показать все результаты (>75) - classic.chem.msu.su/ )

... Class . ... Provides an abstraction for multidimensional array access, some concrete implementations, and ways to view a MultiArray as if it had a different structure. ... This interface defines the services required by MultiArrayProxy to manipulate indexes and the dimensions of a MultiArray. ... In the following, we use the unadorned term "array" to mean the Java language construct, and the term "multidimensional array" for the mathematical abstraction modeled by the MultiArray class in this...

Еще в разделе: (Показать все результаты (>31) - angel.cs.msu.su/ )

• Summary
• : Class ConcreteIndexMap
• : Class Schema

Кафедра общей топологии и геометрии . ... It is proved that a Tychonoff pseudocompact group with continuous multiplication is a topological group. It is also proved that a Tychonoff countably compact group with separately continuous multiplication is a topological group. A continuous function defined on a product X ? Y of pseudocompact spaces is extended to a separately continuous function defined on the product ?( ...

Еще в разделе: (Показать все результаты (>2) - gtopology.math.msu.su/ )

. Please standby and you will be automatically connected to the new location of the unframed Supernova page. Or, click on the link above. If you have questions or problems, please email me at David Bishop dbishop@vhdl.org . Last modified: Mon Aug 27 12:40:15 EDT 2001

Еще в разделе: (Показать все результаты (>440) - www.rochesterastronomy.org/ )

• Supernova 2002fk in NGC 1309
• Supernova 2009js in NGC 918
• Supernova 1999gi in NGC 3184