... The short questionnaire below has been prepared by the Task Force for International Women in American Studies (appointed by the American Studies Association). In case you have already answered a longer questionnaire and expressed your interest in our directory, this will only ask you to confirm your facts and add a small summary of your research interests. ... Co-Chairs, ASA, Task Force for International Women . ...

Еще в разделе: (Показать все результаты (>49) - www.prof.msu.ru/ )

• Short-Term Travel Grants
• Short meetings in the States

... Fast Facts about the Faculty of Journalism . ... Academic Departments . ... Partners . ... All partners . ... International school Russian Media and Journalism-2016 . The Faculty of Journalism annually organizes the English-speaking school ?Russian Media and Journalism?. ... Theoretical module (lectures at the Faculty of Journalism) designed to educate on specific features of the Russian media system; . ... 1999-2014 Faculty of Journalism, Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>167) - www.journ.msu.ru/ )

• Lectures of Dr. Alexandra Stark :: Department of Journalism, M. V. Lomonosov
• Full-time programs :: Department of Journalism, M. V. Lomonosov Moscow State
• News :: Department of Journalism, M. V. Lomonosov Moscow State University <span

... I said, young man, when you're short on your dough. you can stay there, and I'm sure you will find many ways to have a good time. it's fun to stay at the y-m-c-a. it's fun to stay at the y-m-c-a. they have everything for you men to enjoy, you can hang out with all the boys ... it's fun to stay at the y-m-c-a. it's fun to stay at the y-m-c-a. you can get yourself cleaned, you can have a good meal, you can do whatever you feel ... young man, are you listening to me? ...

Еще в разделе: (Показать все результаты (>4833) - crydee.sai.msu.ru/ )

• http://crydee.sai.msu.ru/ftproot/pub/rec/music/lyrics/cs-uwp/folk/k/kilbogie
• http://crydee.sai.msu.ru/ftproot/pub/rec/music/lyrics/cs-uwp/folk/l/lady_diamond
• http://crydee.sai.msu.ru/ftproot/pub/rec/music/lyrics/cs-uwp/h/husker.du/folklore

Leaves opposite; stems with long internodes. ... Capsula with 2 big seeds.: ... Bracts of upper flowers nearly glabrous, it width is bigger, than length. ... Plants 9-14 cm height; mature leaves 5-9 cm length, glabrous, lower leaves are much shorter than upper leaves: P. schrenkii. ... Capsula obtuse, sometimes nearly round, with more than 12 small (near 0.8 mm length) seeds (very rare, plants from coast of Finnish bay - var. winteri - number of seeds is smaller, because part of ovules are aborting). ...

Еще в разделе: (Показать все результаты (>79) - herba.msu.ru/ )

• Systema Naturae

Viscosity Measurements and Hydro dynamic Memory Effects Studied by Optical Trapping Interferometry Guzmґ C., Jeney S., Lukiґ B., Forrґ L. an c o Institut de Physique de la Mati` Complexe, Ecole Polytechnique Fґ ґrale de ere ede Lausanne (EPFL), CH-1015 Lausanne, Switzerland Diffusion governed by Brownian motion is an efficient transport mechanism on short time and length scales. ... A Brownian particle will rapidly explore a heterogeneous environment that in turn strongly alters its tra jectory. ...

Еще в разделе: (Показать все результаты (>6) - www.msm.biophys.msu.ru/ )

• MSM 2007

GLUQ_ECOLI P27305 RecName: Full=Glutamyl-Q tRNA(Asp) synthetase; Short=Glu-Q-RSs; EC=6.1.1.- MTDTQYIGRFAPSPSGELHFGSLIAALGSYLQARARQGRWLVRIEDIDPPREVPGAAETI LRQLEHYGLHWDGDVLWQSQRHDAYREALAWLHEQGLSYYCTCTRARIQSIGGIYDGHCR VLHHGPDNAAVRIRQQHPVTQFTDQLRGIIHADEKLAREDFIIHRRDGLFAYNLAVVVDD HFQGVTEIVRGADLIEPTVRQISLYQLFGWKVPDYIHLPLALNPQGAKLSKQNHAPALPK GDPRPVLIAALQFLGQQAEAHWQDFSVEQILQSAVKNWRLTAVPESAIVNSTFSNASC >GLUQ_SYNP6 Q5N4F9 RecName: Full=Glutamyl-Q tRNA(Asp) synthetase; Short=Glu-Q-RSs; EC=6.1.1.- ...

Еще в разделе: (Показать все результаты (>2964) - kodomo.fbb.msu.ru/ )

• http://kodomo.fbb.msu.ru/~smivic/Projects/1NZJ/downloads/myproteins_aligned.fasta
• Доменная структура белка FABI_ECOLI
• allpy: log

The laboratory runs currently several scientific projects aimed at the foundations of quantum information science (the theories of quantum measurement and entanglement, design and analysis of quantum cryptographic protocols, atoms dynamics in optical dipole trap, etc.), applications of quantum theory to modeling quantum interference phenomena in multilevel atoms interacting with optical and magnetic fields (dark resonance spectroscopy), and exploring ... Physics 96 (4), 629-642 (2003). ...

Еще в разделе: (Показать все результаты (>39) - qilab.phys.msu.ru/ )

... Short Envelope Solitons in Dispersive Media . ... The fundamental classical wave problem of propagation of short (of a order of few wave length) intense high-frequency wave packets in nonlinear dispersive media of different nature is analized. ... Propagation of the short intense wave packets in birefractive nonlinear dispersive media with taking into account polarization effects is analized in the frame of the coupled NSE-3. ... E.M. Gromov, V.I. Talanov, Chaos, 10, 551-558 (2000). ...

Еще в разделе: (Показать все результаты (>34) - acs366.phys.msu.su/ )

• Abstract (Invited)

... ИСТОРИЯ НАУКИ И НАУКА ИСТОРИЯ . ... ПАРАХРОНОЛОГИЯ АКАДЕМИКА А.Т.ФОМЕНКО . ... В.А.Бронштэн, Н.А.Морозов - предтеча творцов "новой хронологии" 11.03.2001 . ... История "новой хронологии", рассказанная авторами. ... A.T. Fomenko The Jump of the second derivative of the Moon's elongation. ... Голубцова Е. С., Завенягин Ю. А. Еще раз о "новых методиках" и хронологии Древнего мира // Вопросы истории. ... Ю.Н.Ефремов, Ю.А.Завенягин, "О так называемой 'новой хронологии' А.Т.Фоменко", Вестник РАН. ...

Еще в разделе: (Показать все результаты (>58) - hbar.phys.msu.ru/ )

• Сайт "Фоменкология" - анализ текстов А. Т. Фоменко

Backlinks to UserTools in Main Web ( Search all webs ) . ... My Links * BeginnersStartHere view a short introductory presentation on Foswiki for beginners * WelcomeGuest starting points on Foswiki * UsersGuide .. ... My Links * BeginnersStartHere view a short introductory presentation on Foswiki for beginners * WelcomeGuest starting points on Foswiki * UsersGuide ... r2 - 22 Dec 2009 - 07:41 by AnatolyGulyaev . ... Ideas, requests, problems regarding Foswiki? ...

Еще в разделе: (Показать все результаты (>1422) - wiki.cs.msu.ru/ )

• (backlinks in all Webs) UserTools < Main < Foswiki
• UserDocumentationCategory < System < Foswiki
• (backlinks in Main Web) WikiUsers < Main < Foswiki

Backlinks to UserTools in Main Web ( Search all webs ) . ... My Links * BeginnersStartHere view a short introductory presentation on Foswiki for beginners * WelcomeGuest starting points on Foswiki * UsersGuide .. ... My Links * BeginnersStartHere view a short introductory presentation on Foswiki for beginners * WelcomeGuest starting points on Foswiki * UsersGuide ... r2 - 22 Dec 2009 - 07:41 by AnatolyGulyaev . ... Ideas, requests, problems regarding Foswiki? ...

Еще в разделе: (Показать все результаты (>3170) - wiki.cmc.msu.ru/ )

• (backlinks in all Webs) UserTools < Main < Foswiki
• UserDocumentationCategory < System < Foswiki
• (backlinks in Main Web) WikiUsers < Main < Foswiki

. unhlp12.pdf . 2016: . CTask 1. ct161.pdf . CTask 2. ct162.pdf . CTask 3. ct163.pdf . CTask 4. ct164.pdf . 2015/16: . NumTask 1. nt151.pdf . NumTask 2. nt152.pdf . NumTask 3. nt153.pdf . NumTask 4. nt154.pdf . NumTask 5. nt165.pdf . NumTask 6. nt166.pdf . NumTask 7. nt167.pdf . 2015: . MaximaTask 1. mt151.pdf . MaximaTask 2. mt152.pdf . MaximaTask 3. mt153.pdf . MaximaTask 4. mt154.pdf . C: chlp12.pdf . Maxima: max07.ps . UNIX: unnu12.pdf . PS output: .

33. The RU-NGI First quarter 2013 Archive by thread

34. EXAFS study of PbS-SnS solid solution

35. SAI Space Monitoring Laboratory

36. Subtyping

37. %TOPICTITLE% (search) - TWiki

38. Events logging

39. http://ofvp.phys.msu.ru/science_education/lections/CS/cp/S2_1.pdf

40. SCOP classification