... О UNИX . ... HelpOnSlideShows . ... SlideShow . Since MoinMoin release 1.9, we have two ways to create slide shows. You can either have your slideshow defined on a single wiki page with level 1 headings separating your slides, or you can have multiple (likely numbered) pages with 1 slide per page. Just create a wiki page and use level 1 headings to define/separate your slides. ... Another way to define slideshows is to use multiple wiki pages (one per slide) and the <<Navigation>> macro. ...
... О UNИX . ... HelpOnSlideShows . ... SlideShow . Since MoinMoin release 1.9, we have two ways to create slide shows. You can either have your slideshow defined on a single wiki page with level 1 headings separating your slides, or you can have multiple (likely numbered) pages with 1 slide per page. Just create a wiki page and use level 1 headings to define/separate your slides. ... Another way to define slideshows is to use multiple wiki pages (one per slide) and the <<Navigation>> macro. ...
Astronomy Picture of the Day . ... 1.01.2000 . ... During millennium two , humanity continually redefined its concept of "Universe": first as spheres centered on the Earth , in mid-millennium as the Solar System , a few centuries ago as the Galaxy , and within the last century as the matter emanating from the Big Bang . ... 1999 2000 . ... NASA Web Site Statements, Warnings, and Disclaimers . ... Publications with keywords: universe - millennium . Publications with words: universe - millennium . ...
... Parsimony method . ... It is based on the following principle: the ancestral sequences (posed in nodes of a phylogenetic tree) should be such that the minimal required number of character replacements on the branches of the tree is less than for any other choice of sequences. ... If the preliminary character of the node is * , but the output character of its immediate ancestor is some letter (say, X ), and its set of possible characters contains X , then the output character of the node is also X . ...
... Definitions . ... file . ... All collective I/O calls on a file are collective over this group. displacement . ... The displacement defines the location where a view begins. ... etype . ... Each process has its own view of the file, defined by three quantities: a displacement, an etype, and a filetype. ... Etypes and filetypes . ... For any given view, the end of file is the offset of the first etype accessible in the current view starting after the last byte in the file. file pointer . ... Центры ....
... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: performance defined to that, people goods . ... a href=http://cheapcelines.zohosites.com/><b>Celine bags</b></a> Moldovos. ... http://www.runpu.net.cn/plus/view.php?aid=340579 . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...
. This Page Requires JavaScript 1.1 . Your browser either does not support JavaScript, or it has JavaScript support disabled. If you want to correctly view this page, please upgrade your browser or enable JavaScript support.
AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...
... Class . ... public class Schema . ... This is a set of ProtoVariable, the DimensionSet which is the union of the Dimensions used, and any global Attributes. ... contains (java.lang.String name) . ... Returns the set of attributes associated with this, also know as the "global" attributes. ... a new Array containing the elements of this set. public ProtoVariable get (java.lang.String name) . ... If a different ProtoVariable with the same name, was in the set, it is returned, otherwise null is...
The Nine Planets is best viewed on-line via a graphical WWW browser which displays the pictures in color and supports hypertext link traversal. ... To view the movies and hear the sounds, you'll need additional helper programs. ... I recommend that you use Netscape as your browser. Netscape can display gif and jpeg images directly without need of any additional helper apps. You do need additional helper apps for movies and sounds, however. ... Yahoo's Helper Applications .. ... Tech Help .. ...
... sepals and stamens - five petals fused at the base to form a tubular structure - found mainly along coastal limestone rocks Six flower color morphs have been observed - pink , yellow , yellow corolla with white calyx flowers, white, orange and ivory - pink and yellow morphs are the most frequent Distribution - Daito and Izu-Ogasawara Islands of Japan - Taiwan (offshore eastern region) - Ryukyu Archipelago Leapfrog ... Common haplotypes were not restricted to a certain flower...
[
Текст
]
Ссылки http://herba.msu.ru/shipunov/school/biol_330/2013_2014/presentations/limonium_flower_color/limonium_flower_color_presentation.pdf -- 1148.7 Кб -- 28.03.2014 Похожие документы
- the current position of the "Universitetskiy" satellite'> . Your browser does not support inline frames :( It must be a very old one. Upgrade to Microsoft Inrernet Expolorer 4 or later, Netscape 6 or later etc. Skobeltsyn Institute of Nuclear Physics.
. Please standby and you will be automatically connected to the new location of the unframed Supernova page. Or, click on the link above. If you have questions or problems, please email me at David Bishop dbishop@vhdl.org . Last modified: Mon Aug 27 12:40:15 EDT 2001
The files containing information about Affymetrix microarrays were downloaded from the official Affymetrix site. ... Probe sequences were mapped to the genome using Blat. ... The hits found "probe alignment regions" were . ... We annotated each probe alignment region using the mRNA and EST alignments provided by UCSC, considering only . ... The textual part of the interface consists of probe information section, probe alignment section and transcription state . ... Each gene and each probe alignment . ...
news ]] . ... Highlight news: CompHEP is in the top rating list on The OpenScience Project . ... 16/03/2009 New official version of CompHEP (4.5.1) is available. ... 14/11/2006 Two new versions of CompHEP-PYTHIA interface (cpyth-1.2.7 and cpyth-2.0.4) are available. ... 13/09/2006 A new version of CompHEP-PYTHIA interface and a new interface CompHEP-HERWIG has been released. ... 01/07/2006 Talk on new physics with CompHEP by M.Dubinin at Tools for SUSY and the New Physics (LAPP, 26-28 June 2006). ...
Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...