The Isaac Newton Institute (Instituto Isaac Newton) for astronomical research (INI) was founded in 1978 by Gonzalo Alcaino. The main office is located in the eastern outskirts of Santiago (Chile). ... The Moscow branch was the first one established outside Chile. ... Besides the above named branches, the Chilean staff of the Isaac Newton Institute is involved in collaboration with astronomers of the Observatory of Rome in several research projects using data secured from telescopes in Chile. ...

Еще в разделе: (Показать все результаты (>419) - xray.sai.msu.ru/ )

• Effect of sources evolution on

Network Working Group RFC # 490 NIC # 15355 references RFC # 436 RFC # 477 John R. Pickens UCSB 6 March, 1973 SURROGATE RJS FOR UCLA-CCN By using UCSB's Network Standard RJS* users can now gain UCLA-CCN's RJS without converting to the UCLA protocol. ... Pickens [Page 2] RFC 490 SURROGATE RJS FOR UCLA-CCN March 1973 Single Job Retrieval -------------------PRINT (JOBNAME) and PUNCH (JOBNAME) are used to explicitly fetch print and punch output, respectively. ... PRINT (*) - Retrieve all print jobs. ...

Еще в разделе: (Показать все результаты (>19886) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc125.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc125.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc339.txt.pdf

This module provides for documents with Server Side Includes (SSI). ... Any document with handler of "server-parsed" will be parsed by this module, if the Includes option is set. If documents containing server-side include directives are given the extension .shtml, the following directives will make Apache parse them and assign the resulting document the mime type of text/html : AddType text/html .shtml AddHandler server-parsed .shtml The following directive must be given for ... cgi . ...

Еще в разделе: (Показать все результаты (>102) - neptun.sai.msu.ru/ )

• Apache Tutorial: Introduction to Server Side Includes
• Using Apache with HP MPE/iX

The %IF% construct gives TWiki the power to include content in topics based on the value of simple expressions. IF{"CONDITION" then="THEN" else="ELSE"}% . ... context . True if the current context is set (see below) . ... Check access permissions You %IF{"'%TOPIC%' allows 'change'" then="can" else="cannot"}% change this topic. ... in attach script (see TWikiScripts ) . ... in changes script (see TWikiScripts ) . ... in rdiff script (see TWikiScripts ) . ... in edit script (see TWikiScripts ) . ...

Еще в разделе: (Показать все результаты (>37911) - dualopt1.cmm.msu.ru/ )

• IfStatements - TWiki - TWiki
• %TOPICTITLE% (5 vs. 6) - TWiki

... 3 Data Types Perl has three basic data types: ffl scalars ffl arrays of scalars ffl associative arrays of scalars (also known as hash tables) 3.1 Scalars The scalar is the basic data type in Perl. ... Consider this code fragment: $x = 4; # an integer $y = ''11''; # a string $z = $x+$y; print $z,''``n''; After this code is executed, $z will have a value of 15. ... EOM— 3.2 Arrays of Scalars Perl scripts can have arrays (or ``lists'') consisting of numeric values or strings. ...

Еще в разделе: (Показать все результаты (>599) - rtm-cs.sinp.msu.ru/ )

• Apache module mod_include
• Linux Threads Home Page: How do Linux Threads compare with other OSs'?
• Interface Repository

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>186) - www.genebee.msu.ru/ )

• AliComp - GeneBee Alignments Comparison - Advanced
• Genebee ClustalW 1.83 Help
• GeneBee BLAST 2.2.8 Services

... Ph.D., Associate Professor, Oryol branch, Russian Presidential Academy of National Economy and Public Administration, Oryol, Russian Federation. ... The article examines the personality of the count P.V. Gendrikov and his activities as a governor of the Oryol province during the February revolution in Russia. ... Russian province, Oryol region, elite, governor, February revolution, personality in the history. ... Public Administrarion". ...

Еще в разделе: (Показать все результаты (>289) - ee-journal.spa.msu.ru/ )

II INTERNATIONAL CONFERENCE "ELECTRONICS AND APPLIED PHYSICS" Taras Shevchenko National University of Kyiv, Radiophysics Faculty 11-14 October 2006, Kyiv, Ukraine The conference is organized by |[pic] |Taras Shevchenko |[pic] |RadioPhysics | National University | ... of Kyiv | ... The main organizer of the Conference is the Radiophysics Faculty of Taras Shevchenko National University of Kyiv. ... Address Radiophysics Faculty of Taras Shevchenko National University of Kyiv, 2, Acad. ...

Еще в разделе: (Показать все результаты (>99) - phys.msu.ru/ )

List of Publications . ... Palyulin V.V., Potemkin I.I. Article " Microphase Separation in Melts of Double Comb Copolymers ", Polymer Science, Ser. ... Palyulin V.V., Potemkin I.I., Microphase separation of double-grafted copolymers (centipedes) with gradient, random and regular sequence of the branch points , Journal of Chemical Physics, 2007 , 127, 124903. ( download ) . ... Palyulin V.V., Potemkin I.I., "Microphase separation in double comb copolymer melts , . ... Palyulin V.V., Potemkin I.I., " . ...

Еще в разделе: (Показать все результаты (>350) - polly.phys.msu.ru/ )

• Polymers with Associating Groups (experiment + theory + computer experiment) -
• Polymer and Soft Matter Theory Lab - Official Website
• Main Directions of Scientific Research of the Chair and Laboratory in 2012 -

Gamma Ray Earth . ... The Earth's gamma-ray glow is indeed very faint, and this image was constructed by combining data from seven years of exposure during the life of the Compton Gamma Ray Observatory , operating in Earth orbit from 1991 to 2000. Brightest near the edge and faint near the center, the picture indicates that the gamma rays are coming from high in Earth's atmosphere. ... NASA Web Site Statements, Warnings, and Disclaimers . NASA Official: Jay Norris. ...

Еще в разделе: (Показать все результаты (>73201) - www.astronet.ru/ )

• Gamma Ray Earth
• Астронет > Gamma Ray Earth
• Spitzer s Orion

... Peculiarities of flavonoids separation by reversed-phase high-performance chromatography on Luna 5u C18(2) column . Abstract The chromatographic behavior of several flavonoids (quercetin, naringenin, chrysin, morin, rutin and naringin) on Luna 5u C18(2) column was studied. ... Moscow University Chemistry Bulletin . 2012, Vol. ... 6, P. 369 . Copyright (C) Chemistry Dept., Moscow State University, 2002 . ... Copyright (C) Chemisty Department of Moscow State University . ...

Еще в разделе: (Показать все результаты (>734) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 50, No. 6, P. 411 (2009)
• Laboratory of kinetics and catalysis
• Stanislava G. Dmitrienko

... Apache HTTP Server Version 2.0 . ... Server-parsed html documents (Server Side Includes) . ... If documents containing server-side include directives are given the extension .shtml, the following directives will make Apache parse them and assign the resulting document the mime type of text/html : . ... As well, Apache will activate the INCLUDES filter for any document with mime type text/x-server-parsed-html or text/x-server-parsed-html3 (and the resulting output will have the mime type text/html )....

Еще в разделе: (Показать все результаты (>2346) - uneex.lorien.cs.msu.su/ )

• Chapter€а2.€а Fire up the GIMP
• Apache Tutorial: Introduction to Server Side Includes - Apache HTTP Server
• rpmrc File Entries

... The LanHEP input file is the sequence of statements, each starts with a special identifier (such as parameter, lterm etc) and ends with the full-stop ' . ... This section is aimed to clarify the syntax of LanHEP input files, i.e. the structure of the statements. ... Let us consider the LanHEP input files for the Standard Model with both the t'Hooft-Feynman and unitary gauges. ... LanHEP allows the user to define several keys , and use these keys to branch among several variants of the model. ...

Еще в разделе: (Показать все результаты (>764) - theory.sinp.msu.ru/ )

• Stratified sampling
• Lagrangian expressions
• [Comphep-common] Polarization of outgoing particles

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>164) - www.pereplet.ru/ )

Moss, D., Sokoloff, D., Lanza, A. F..Polar branches of stellar activity waves: dynamo models ad observations. Astronomy and Astrophysics, 531, A43, 12 pages, 2011 . ... Taking into account the preliminary stage both of observations of polar activity branches and of the determination of the governing parameters for stellar dynamos, we restrict our investigation to the simplest mean-field dynamo models, while recognizing more modern approaches to be an essential development. ...

Еще в разделе: (Показать все результаты (>97) - srcc.msu.ru/ )

• D.D.Sokoloff, A.F.Lanza, D.L. Moss, S.M.Tarbeeva. Polar branches of stellar
• P. Frick, D.Sokoloff, R. Stepanov, R. Beck)Faraday rotation measure synthesis

... Uropatagium venation pattern in bats as diagnostic character (by the example of genus Myotis ) . ... References Download PDF . ... I examined 14 craniometric features of 128 specimens of Ochotona mantchurica from the entire distribution range. ... Morphological variation and integration of dentition in the Arctic fox ( Vulpes lagopus ): effects of island isolation . ... Patterns of the spatial distribution of species numbers and species composition homogeneity were obtained. ...

Еще в разделе: (Показать все результаты (>1358) - zmmu.msu.ru/ )

• On a taxonomic position of the weasel (Carnivora, Mustela) from the Cheju
• Host-associated differentiation in batbugs - abstract
• Inherited dental anomalies in the horse (Equidae, Equus caballus)

... Издательство: American Association for Cancer Research . ... Karpechenko N.Yu , Gasanova V.K. , Dolinnaya N.G. , Popenko V.I. , Yakubovskaya M.G. в журнале Cancer Research , издательство American Association for Cancer Research (United States) , том 72, ? ... в журнале Cancer Research , издательство American Association for Cancer Research (United States) , том 72, ? ... в журнале Cancer Research , издательство American Association for Cancer Research (United States) , том 71, с. 2230-2239 . ...

Еще в разделе: (Показать все результаты (>2806) - istina.msu.ru/ )

• Compare - журнал | ИСТИНА - Интеллектуальная Система Тематического Исследования
• VASILIEV VP - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Gotta D. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

... Levels of fatty acid binding protein before and after direct current cardioversion of atrial fibrillation or flutter in patients without acute coronary syndrome]. ... CONCLUSION: Unexpectedly most pts with AF and atrial flutter had elevated FABP at baseline. ... AF, atrial flutter and DCC for these arrhythmias should be considered as sources of false positive results when FABP is used for diagnosis of acute myocardial infarction. ...

Еще в разделе: (Показать все результаты (>68) - biochem.bio.msu.ru/ )

• Characterization of human small heat shock protein HspB1 that carries

... Laser Optoacoustic Imaging System in Application for Cancer Diagnostics . ... Principles of the optoacoustic tomography, current status of development of the Laser Optoacoustic Imaging System (LOIS) and its applications for cancer detection and characterization will be reviewed based on results of collaborative efforts at the University of Texas Medical Branch, LaserSonix Technologies Incorporated and Moscow State University. ...

Еще в разделе: (Показать все результаты (>175) - acs366.phys.msu.su/ )

• Abstract
• AUTHOR : Yost W

Russian page . Office: room A-402 (or C-03), Geological Department, Moscow State University, Vorobievi Gori, Moscow,119899, Russia Office Phone 07(095)-939-18-41, Fax: 07(095)-9328889 Email: pavel@web.ru . My Biographical INFO is not interesting, and you could skip it .. ... Associate Proffessor, Moscow State University, Geological Department, Experimental Petrology & Data Processing. ... Volcanism of the Kurile-Kamchatka Arc is a one of the most interesting petrologic problem. ...

Еще в разделе: (Показать все результаты (>578) - geo.web.ru/ )