... Другие названия журнала: Phys. Status Solidi C , PHYSICA STATUS SOLIDI C , PHYSICA STATUS SOLIDI C: CURRENT TOPICS IN SOLID STATE PHYSICS показать полностью.. ... Borisyuk P.V. , Vasilyev O.S. , Krasavin A.V. , Lebedinskii Yu Yu , Troyan V.I. , Tkalya E.V. в журнале Physica Status Solidi (C) Current Topics in Solid State Physics DOI . ... Tselikov G.I. , Emelyanov A.V. , Antropov I.M. , Demin V.A. , Kashkarov P.K. в журнале Physica Status Solidi (C) Current Topics in Solid State Physics , том 12, ? ...

Еще в разделе: (Показать все результаты (>899) - istina.msu.ru/ )

• Physica Status Solidi (A) Applications and Materials - журнал | ИСТИНА -
• Physica status solidi (A): Applied research - журнал | ИСТИНА -
• physica status solidi (b) - журнал | ИСТИНА - Интеллектуальная Система

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>7) - storage.bioinf.fbb.msu.ru/ )

You are here: Foswiki > System Web > JQueryPlugin > JQueryPNotify (revision 1) E dit A ttach . ... Full featured plugin to show temporary floating messages for status updates, actions and errors. Call $.pnotify(options) to show a notification. ... text : the message text . ... nonblock : true if items below the message should be clickable . ... function called when the message is being initialized . ... function called when the message has been initialized . ... called before a message is closed . ...

Еще в разделе: (Показать все результаты (>2189) - wiki.cs.msu.ru/ )

• YahooUserInterfaceContrib < System < Foswiki
• FootNotePlugin < System < Foswiki
• IncludeTopicsAndWebPages < System < Foswiki

. Example of the Fortran menu . b ,B ,W+ * ****************************************************************** * x: Exit hN: Help (N-menu position) m: MAIN menu * * * * 1: Subprocess 2: IN state * * 3: Model parameters 4: QCD SCALE * * 5: Breit-Wigner 6: Cuts * * 7: Kinematics 8: Regularization * * 9: Vegas 10: Simpson * * 11: Batch 12: View result * ***************************************************************** Type number of menu position and press ENTER:_

Еще в разделе: (Показать все результаты (>1611) - theory.sinp.msu.ru/ )

• Examples
• Example: Summation of diagrams and symbolic integration by means of the Reduce
• fc3:dokuwiki:example [THEP]

... When two grd files are on the stack, each element in file A is modified by the corresponding element in file B. However, some operators only require one operand (see below). ... COSD 1 cos (A) (A in degrees). ... I0 1 Modified Bessel function of A (1st kind, order 0). ... INV 1 1 / A. J0 1 Bessel function of A (1st kind, order 0). J1 1 Bessel function of A (1st kind, order 1). ... K1 1 Modified Bessel function of A (2nd kind, order 1). ... Y0 1 Bessel function of A (2nd kind, order 0). ...

Еще в разделе: (Показать все результаты (>402) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~ivan/gmt/man/gmtmath.html
• http://xray.sai.msu.ru/~ivan/gmt/man/grdedit.html
• xmgr: Help (draft)

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: ten example, Dragon of current high-end C . ... a href=http://buyhermes.zohosites.com/><b>Hermes Outlet</b></a> How much home do you've got for example? ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>10353) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: example, with Rolex, showing
• Экологический Форум - Фундаментальная Экология: example, IWC such I is States.
• Экологический Форум - Фундаментальная Экология: on the will example, refine

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>56) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>13) - tukachev.flogiston.ru/ )

• Category: Новости

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>18) - mouse.belozersky.msu.ru/ )

• Alignment example
• Example of alignment
• PLANdbAffy: probe-level annotation database for Affymetrix expression

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>134) - bioinf.fbb.msu.ru/ )

• Alignment example
• User's guide

... 2015 . ... Postgraduate student, School of Public Administration, Lomonosov Moscow State University. ... The article examines the media image of a federal executive authority Ministry of Justice of the Russian Federation. The main topical blocks with reference to the Ministry of Justice of the Russian Federation are composed on basis of the analysis of media publications. The positive and negative aspects of the Russian Ministry of Justice media image have been revealed. ...

Еще в разделе: (Показать все результаты (>239) - ee-journal.spa.msu.ru/ )

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>110) - monkey.belozersky.msu.ru/ )

• Example of supporting positions
• SCOP famyli:
• SDPpred

... I mean the following Theorem If any local eld (x) is irreducible and [ (x), (y )] = B (x - y ), (1) then operator B (x) is multiple of unit operator, that is (x) is an asymptotic eld. ... Our result is most interesting in the case of noncommutative theory, precisely, in the case of space-space noncommutativity, in which time commutes with spatial variables and, as a consequence, one spatial variable, say x3, commutes with others. ... For simplicity we consider the case of neutral scalar elds. ...

Еще в разделе: (Показать все результаты (>144) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks/GRACE.pdf
• http://qfthep.sinp.msu.ru/talks/GRACEV2.pdf
• http://qfthep.sinp.msu.ru/talks2011/anomalous_wtb_qfthep11.pdf

... Preface to Research Project "High-Level Decision Making in the Soviet Administrative-Command Economy", . ... This introductory article summarizes the High-Level Soviet Decision Making Project of which the Lazarev and Belova papers are examples. It explains that social scientists must use the modern methods of information economics and the New Economic History to study the Soviet state and party archives using methods of interests to economists and political scientists in general. ...

Еще в разделе: (Показать все результаты (>117) - hist.msu.ru/ )

• Corporate Social Policy as an Approach to Managing the Workforce: Some Examples
• Economic History. Yearbook. 2001

DVM-system of parallel program development . Installation guide . ... 1 DVM-system installation under Windows95/NT . ... Microsoft Visual C++ 5.0 version and later (4.0 version can be used with some restrictions, see below); . ... Now the user should copy all files from directory dvm_sys/user to his own directory with DVM programs. ... In this case (but if DVM-system installation was succesfully verified) the user should keep above files with errors and ask for system programmer support. ...

Еще в разделе: (Показать все результаты (>132) - sp.cs.msu.ru/ )

• DVM-system. Installation guide. Version 3.30
• DVM-system. Installation guide. Version 3.60
• DVM-system. Installation guide. Version 3.82

... Results Comparison with FASTA archaean genomes. ... But each of these programs has some signicant Table 1: Numb er of found alignments with E-value less than given Program FASTA Nhunt Run time 5.5 1.4 Example alignment : Query: ctgtttaccaggtcaggtccggaaggaagcagccaaggcagatgacgcgt aaaaaaaa||||aa|||||a|a|aaa|||a||aa|| |||||||aa||a|||aa||a| Sbjct: ctgtgaaccagcttatcgccgcaatcaaacagccaaatcatatgcagcat Identity = 33/50 (66%) Strand: Plus/Minus Alignment features without scoring ...

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• Nhunt: program for nucleic acid sequence similarity search
• ConClus

... The main problem is increasing the recognition rate of some recognition engines, working in some restricted domains, such as telephone time-table question-answer systems and so on. ... Our algorithms allow user to get recognition variants, which are right sentences in some formal language. ... We suppose that BRE can produce a set of recognition variants in the form of the "complex chain". ... Length of complex chain is the number of vertexes in its graph. ... const*n^2 . ...

Еще в разделе: (Показать все результаты (>63) - www.intsys.msu.ru/ )

• Intelligent Systems :: Staff :: Strogalov Alexander Sergeevich :: Modeling

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Outlook и HELO command . ... Outlook "HELO/EHLO"-Bug . ... Outlook doesn't care, it just always send's the computers nickname. ... Re: Outlook и HELO command [ re: alpha ] . ...

Еще в разделе: (Показать все результаты (>2115) - www.snto-msu.net/ )

• Программисты шутят - Public forum of MSU united student networks
• Status и форумчане, 2005 год - Public forum of MSU united student networks
• Детализация рейтинга: Status - Public forum of MSU united student networks

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Outlook и HELO command . ... Outlook "HELO/EHLO"-Bug . ... Outlook doesn't care, it just always send's the computers nickname. ... Re: Outlook и HELO command [ re: alpha ] . ...

Еще в разделе: (Показать все результаты (>3570) - www.fds-net.ru/ )

• Программисты шутят - Public forum of MSU united student networks
• Детализация рейтинга: Status - Public forum of MSU united student networks
• Status и форумчане, 2005 год - Public forum of MSU united student networks

Online Services | ... Nuclear Wallet Cards" . USA National Nuclear Data Center - NNDC . ... Nuclei Selection: . All nuclei Only even Only odd . ... Decay Type: . decay . ... CDFE Head: Vladimir V. Varlamov . ...

Еще в разделе: (Показать все результаты (>21) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Nucleus Ground State Parameters
• CDFE provides the major photonuclear databases. Online Services.