. The work is supported by the Russian Foundation for Basic Research, grant 10-07-00685-a . PDB . Classification . Domain instances . Bonded with NA . 1BMV . VIRUS/RNA . 1 . 0 . 1PGL . VIRUS/RNA . 1 . 1 . total (2 entries) . 2 . 1 . No comments on this family . Send your questions and comments to sas@belozersky.msu.ru .

Еще в разделе: (Показать все результаты (>157) - monkey.belozersky.msu.ru/ )

• SCOP classification

... Научные семинары . ... Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: Obtaining a Large Effect From your own Sm . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . Вы не можете публиковать новые темы в этом форуме . Вы не можете отвечать на сообщения в этом форуме . ...

Еще в разделе: (Показать все результаты (>3110) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: not meet data largest and the
• Экологический Форум - Фундаментальная Экология: etc.), large it to This billion
• Экологический Форум - Фундаментальная Экология: term, Tiffany to large that

... Large potentials of small heat shock proteins. ... HSPB1 directly or indirectly participates in the regulation of apoptosis, protects the cell against oxidative stress, and is involved in the regulation of the cytoskeleton. ... All small heat shock proteins play important "housekeeping" roles and regulate many vital processes; therefore, they are considered as attractive therapeutic targets. ...

Еще в разделе: (Показать все результаты (>29) - biochem.bio.msu.ru/ )

• Biochemistry Department of Moscow State University | Education

... The role of wine tax-farming system in the forming of large capitals in Russia in the 19th century, . ... The article is devoted to one of the most profitable business activities in Russia at the end of the 18th century to the beginning of the 1860s. The author researches the social and national structure of wine tax-farmers, the level of their incomes as well as the ways and methods of accumulation of capital, in particular, their ties with the aristocracy and state officials of all levels. ...

Еще в разделе: (Показать все результаты (>62) - hist.msu.ru/ )

The Ecological Cooperation Project is the first large-scale children's network project in Russia. This project was founded on the principles of development and achievement of widespread nature awareness among Russian school children through the establishment and unification of numerous childrenтАЩs ecological projects. ... Nature Protected Areas . ... The Project is open for cooperative learning, and any childrenтАЩs ecological organization or group is welcome to participate. ...

Еще в разделе: (Показать все результаты (>5) - www.ecocoop.ru/ )

... About lab . ... Conference "GraphiCon" . Online Journal "Computer graphics and multimedia" (in russian) . ... Large-lexicon attribute-consistent text recognition in natural images . ... Conference Paper . ... Conference Name . ... Project: Text detection and recognition in natural images . ...

Еще в разделе: (Показать все результаты (>69) - graphics.cs.msu.ru/ )

• A system for large-scale automatic traffic sign recognition and mapping |

. General Information . Media Files . Participants . Timetable . Local Information . Photos . Back to the album list . Previous Click the image to view it in fullsize. Previous . The BTA (Bolshoi Teleskop Alt-azimutalnyi, Eng:Large Altazimuth Telescope) is a large 6 m optical telescope at the Special Astrophysical Observatory. The BTA-6 was the largest telescope in the world between its first light in 1975 and 1993.

Еще в разделе: (Показать все результаты (>187) - site2010.sai.msu.ru/ )

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>385) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.cmm.msu.ru/~is_rusinov/projects/Alignment/deltaH.fasta

.

Еще в разделе: (Показать все результаты (>42) - comet.sai.msu.ru/ )

• Previous and Proposed
• The IMG (Image) Element
• Network domains and mail addresses

Projects . ... SmpB . During trans- translation, stalled bacterial ribosomes are rescued by small protein B ( SmpB ) and by transfer-messenger RNA (tmRNA). ... We present evidences that SmpB binds the large and small ribosomal subunits in vivo and in vitro . ... SmpB contacts the large subunit transiently and early during the trans -translational process. The affinity of SmpB for the two ribosomal subunits is modulated by tmRNA in the course of trans -translation. ...

Еще в разделе: (Показать все результаты (>33817) - dualopt1.cmm.msu.ru/ )

• SmpB - Projects - TWiki - (printable)
• %TOPICTITLE% ( vs. 1) - TWiki
• %TOPICTITLE% (17 vs. 18) - TWiki

... Handling file uploads . ... The MAX_FILE_SIZE item cannot specify a file size greater than the file size that has been set in the upload_max_filesize ini-setting. ... If memory limit is enabled, larger memory_limit may be needed. Make sure to set memory_limit large enough. ... Make sure to set max_execution_time large enough. If post_max_size is set too small, large file cannot be uploaded. Make sure to set post_max_size large enough. ... Uploading multiple files ...

Еще в разделе: (Показать все результаты (>125) - oit.cmc.msu.ru/ )

• pg_locreate
• PostgreSQL functions
• pg_loopen

/Research/virus/capsidsIndex of /Research/virus/capsids Name Last modified Size Description Parent Directory - 1a6c-5A-large.jpg 18-Nov-2006 00:40 130K 1a6c-to-scale.jpg 18-Nov-2006 00:40 4.2K 1a34-5A-large.jpg 18-Nov-2006 00:40 74K 1a34-to-scale.jpg 18-Nov-2006 00:40 1.6K 1al0-5A-large.jpg 18-Nov-2006 00:40 140K 1al0-to-scale.jpg 18-Nov-2006 00:40 5.5K 1al0_t1-5A-large.jpg 18-Nov-2006 00:40 99K 1al0_t1-to-scale.jpg ... 18-Nov-2006 00:40 5.0K ccmv_t2_672919-5A-la.. ...

Еще в разделе: (Показать все результаты (>1823) - kodomo.fbb.msu.ru/ )

• cca: a308291203ea state.py
• allpy: ab9e2260a60a lib/block.py
• allpy: ab9e2260a60a sandbox/gl.py

... This paper argues that a mixed system of private and state universities seems the best structure to secure dynamism, accessability, and efficiency of higher education insitutions in post-industrial societies. ... Whereas the university system of Germany is to a large degree state-operated, the British system combines some elements of private higher education with an also largely state-operated university system. ... The United States would seem to provide the best structure for a university system. ...

Еще в разделе: (Показать все результаты (>53) - www.prof.msu.ru/ )

• Commemoration of the centenary of Senator Fulbright's birth
• Civic Liberties and Education

... The Council on Complex Problems of Cosmic Rays of the Russian Academy of Sciences and the Skobeltsyn Institute of Nuclear Physics (SINP) of Lomonosov Moscow State University are planning to held a workshop "Cosmic Ray Physics Large Scale Experiments at the Second Decade of the 21st Century" on May 16-18 2011 at the Moscow State University. ... The Workshop banquet will be held on Tuesday, May 17 th . ... Workshop тАЬCosmic Ray Physics Large Scale Experiments at the Second Decade of the 21st Century"...

Еще в разделе: (Показать все результаты (>6) - tunka.sinp.msu.ru/ )

July 15, 2000 Geomagnetic Storm Animation . The Bastille Day storm of July 15-16, 2000 has been the largest geomagnetic storm to-date during Solar Cycle 23. While this is a major storm, it is not large enough to fit the category of a Superstorm. ... Some very intense electrojet conditions were observed across North America from 20UT - 24 UT on July 15, 2000. This animation illustrates the extent and dynamic behavior of the electrojet from times 21:00-22:20 UT on July 15 over North America. ...

Еще в разделе: (Показать все результаты (>76) - www.kosmofizika.ru/ )

• Top Story - X 17.1 Flare Observed - October 28, 2003
• Science Technology: Ongoing Solar Activity

... Our Partners . ... URALCHEM Holding P.L.C., a company incorporated in Cyprus and the holding company for URALCHEM Group, one of the largest producers of nitrogen and phosphate fertilizers in Russia and the CIS. ... Thermodynamics center of precise calorymetry investigations.љ ... Facility for the Analysis of Chemical Thermodynamics ( Decterov S.A. љ? ... Colloquium on 24.12.12 20 Dec 2012 . ... Laboratory of Chemical Thermodynamics . ... 2000-2016 Laboratory of Chemical Thermodynamics . ...

Еще в разделе: (Показать все результаты (>3) - td.chem.msu.ru/ )

... 21 Дек 2015 . кем editor | ... 16 Мар 2015 . ... Родилась 31.01 1932 г. 2 Мар 2015 . ... 5 Май 2015 . ... Декабрь 2015 . Ноябрь 2015 . ... 2016 С Днем Победы! ... win 7 ultimate product key Windows 8 key windows 7 key win 7 key windows 7 pro product key win 7 pro product key windows 7 activation key windows 7 ultimate product key windows 7 ultimate serial key windows 7 key online win 7 ultimate key win 7 serial keys Win 7 ultimate ...

Еще в разделе: (Показать все результаты (>45) - elana.sinp.msu.ru/ )

• Your car really need to be free of rust spots over the long-term to prevent

... 2015 . ... Senior lecturer, School of Public Administration, Lomonosov Moscow State University. ... The article analyzers the public large-scale business support measures implemented by the Russian Government during the global financial crisis. The author estimates the effectiveness of this measure and analyzes the current state and dynamics of Russian businesses which received the government relief packages during the crisis (on the example of the metallurgy industry). ... Public Administrarion". ...

Еще в разделе: (Показать все результаты (>31) - ee-journal.spa.msu.ru/ )

Storing and accessing the largest astronomical catalogues with the SAI CAS project S. Koposov1,2,3, O. Bartunov2, S. Karpov4 et al2. ... Why we want to build our own Catalogue Access Service The requirements for our CAS system The importance of the Database for the CAS (PostgreSQL & Q3C) The technical realization of CAS What has been already done Example of work TODO Storing and Accessing Astronomical Catalogues Existing projects CDS OpenSkyQuery CASjobs with SDSS They are all really great! ...

Еще в разделе: (Показать все результаты (>124) - lnfm1.sai.msu.ru/ )

• http://lnfm1.sai.msu.ru/~tempus/english/science/articles/Poster_DZZ2015.pdf
• http://lnfm1.sai.msu.ru/~tempus/english/science/articles/ZotovPoster_APSG2013.pdf
• HSFA 2 technical description Technical Details

Next: Using a Direct Connection Up: UUCP Configuration Files Previous: How to Dial a . Absurd as it may sound at the first moment, using UUCP to transfer data over TCP not that bad an idea, especially when transferring large amount of data such as Usenet news. ... The corresponding port entry would read: . ... This is the default port number of the UUCP service. Instead of the port number, you may also give a symbolic port name to the service command. ...

Еще в разделе: (Показать все результаты (>145) - itpm.msu.su/ )

• Allocating swap space
• File Descriptor Limits - Apache HTTP Server
• Selecting the backup tool