... Understanding Attitudes and Predicting Social Behaviour. ... Bandstatter, H. (1993). Should Economic Psychology care about personality structure? Journal of Economic Psychology, 14(3), 473-494. Berthoud, R., and Kempson, E. (1990). ... Journal of Economic Psychology, 11(4), 545-556. ... British Journal of Social Psychology, 28, 159-171. ... Journal of Economic Psychology, 14(2), 337-376. ... The Economic Mind: The social psychology of economic behaviour. ... The Social Psychology of Aging. ...
Economic, industry and corporate trends A report from the Economist Intelligence Unit sponsored by Cisco Systems Foresight 2020 Economic, industry and corporate trends Contents Preface Executive summary Chapter 1: The world economy Chapter 2: Industries Automotive Consumer goods and retailing Energy Financial services Healthcare and pharmaceuticals Manufacturing Public sector Telecoms Chapter 3: The company Appendix I: Survey results 2 3 6 22 24 30 36 43 50 57 62 67 74 86 Appendix II: Methodology for
[
Текст
]
Ссылки http://bc.fdo.msu.ru/Nik_s/WorkFiles/DOC_files/World_shares_foresight_2020.pdf -- 425.8 Кб -- 20.03.2012 Похожие документы
hpc@cmc . Высокопроизводительные вычисления на ВМК МГУ . Blue Gene/P . Regatta . ... Серия Blue Gene в мире . ... Факультет вычислительной математики и кибернетики МГУ . ... parallel.ru . ... Parallel Computing . ... Некоммерческое программное обеспечение Intel : . ... Часть ссылок и описаний к ним любезно предоставлена администратором сайта кафедры АНИ факультета ВМК МГУ имени М. В. Ломоносова . Факультет ВМК МГУ . ... 2008 2013 Факультет ВМК МГУ имени М. В. Ломоносова . ...
... Recommended values . Start word length . Start length of motiff for Multiple sequence alignment. ... Max N Mismatches . ... Min score . ... Gap parameter . This parameter defines gap scoring. the grater this value is the stronger gap will be panalysed . ... If inforation content of a column is less than given value the column should be not included into alignment. the grater this value is the stronger gap will be panalysed . ... Max loop . Max energy of a helix . ... cgcatagctc cacca . ...
... Елена Фоменко (2 курс). ... Руководитель В. И. Буник, отдел биокинетики НИИ ФХБ им. А.Н.Белозерского МГУ. ... Руководитель А.Г. Евстафьева, отдел химии и биохимии нуклеопротеидов НИИ ФХБ им. А.Н. Белозерского МГУ. ... Руководитель Н.В. Чичкова, лаборатория молекулярной биологии гена отдела химии и биохимии нуклеопротеидов НИИ ФХБ им. А.Н. Белозерского МГУ. ... Руководитель А.Г. Евстафьева, лаборатория молекулярной биологии гена отдела химии и биохимии нуклеопротеидов НИИ ФХБ им. А.Н. Белозерского...
ДД PROCEEDINGS OF THE 31st ICRC, LODZ 2009 1 Preliminary Proton and Helium Spectra from the CREAM-III Flight Y. S. Yoon , H. S. Ahn , T. Anderson, L. Barbier?, ... Keywords: CREAM; energy spectra; protons and helium nuclei I . ... CREAM-III I N S T RU M E N T A N D F LIGHT The CREAM-III instrument consisted of a tungsten/scintillating fiber calorimeter, a dual layer Silicon Charge Detector (SCD), a Cherenkov Camera (CherCam), a Cherenkov Detector, and a Timing Charge Detector (TCD). ...
. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .
ISTITUTO NAZIONALE DI FISICA NUCLEARE Sezione di Genova INFN/code-98/001 October 4, 2007 MEASUREMENT OF THE FREQUENCY RESPONSIVITY OF A FIBER OPTIC AIR BACKED MANDREL HYDROPHONE UP TO 10 KHZ IN AIR M.Anghinolfi1, A.Bersani1, A.Calvi3, A.Cotrufo3, M.Ivaldi1, O.Ershova2, F.Parodi1, D.Piombo1, A.Plotnikov2 and L.Repetto3 Hydrophone calibration was performed with the help of a microphone with a known frequency response characteristic. ... 3.2 F 1 F1 + F F = 23.9 kHz 380 ns ~130 ns 3200 ns FIG. ...
... Voronov, Vasiliy. Scalability and efficiency of parallel power grid simulations on massively-parallel platforms (submitted). ... 2009. ... Voronov, Vasiliy and Popova, Nina. ... Conference proceedings 2010. ... Abstract Book of SIAM Conference on Parallel Processing for Scientific Computing (SIAM PP10). ... Proceedings of the International Conference on Parallel Computing (ParCo-2009). ... IEEE Computer Press. ... Pozdneev, Alexander and Popova, Nina and Voronov, Vasiliy. ...
Curriculum Vitae . ... Lomonosov Moscow State University , Faculty of Computational Mathematics and Cybernetics . ... Lomonosov Moscow State University , Faculty of Physics . ... 2010 - till now . ... Research Scholar . ... Scholarship supporting perspective young scientists and teachers of Lomonosov Moscow State University who achieved significant results in teaching and research . ... Kurchatov Scholarship for excellent students of the Faculty of Physics, Lomonosov Moscow State University . ...
... Konarev D.V., Kuzmin A.V., Troyanov S.I., Nakano Y., Khasanov S.S., Otsuka A., Yamochi H., Saito G., Lyubovskaya R.N. Anionic coordination complexes of C 60 and C 70 with cyclopentadienyl and pentamethylcyclopentadienyl molybdenum dicarbonyl , Dalton Transactions (2015) 44 , 9672-9681 DOI . Ioffe I.N., Yang S., Wang S., Sidorov L.N., Kemnitz E., Troyanov S.I. C 100 is converted into C 94 Cl 22 via three chlorination-promoted C 2 losses under formation and elimination of cage heptagons , Chem. ...
The principles of the double-flash fluorometry . ... During a weak probe flash (measuring light) chlorophyll fluorescence is measured with photosynthetic reaction centers of phytoplankton in the open (active) state; the fluorescence intensity reflects phytoplankton concentration in water samples.The actinic flash induces transition of reaction centers into the closed (inactive) state. ... During the second probe flash, chlorophyll fluorescence from closed reaction centers ( Fm ) is measured. ...
... Публикации . ... О ВШГА МГУ . ... ВШГА МГУ - это подготовка кадров среднего и высшего звена для органов государственной власти РФ, крупных государственно-частных корпораций и бизнес-структур. ... Принципы и особенности развития межрегиональных центров подготовки кадров для государственного управления . ... В этой статье мы остановимся подробно на принципах и особенностях развития межрегиональных центров подготовки кадров для государственного управления. ... Новости и публикации | ...
... The kinetics of the ESR signal from P700 (ESR signal I) was recorded at different concentrations of exogenous ferredoxin, ,A kinetic model was developed for ferredoxin-dependent cyclic electron transport around photosystem I. A multiparticle model was built to directly describe electron transfer in multienzyme complexes and restricted diffusion of mobile carriers in individual compartments (stroma, lumen, intramembrane space) of the system. ... Ferredoxin Lumen Photosystem I Plastocyanin Fig. ...
Физический факультет МГУ имени М.В. Ломоносова и Научно-образовательный центр по нанотехнологиям МГУ проводят научный семинар по физике конденсированного состояния. ... Аннотация . ... В режиме асимметричной связи магнитной примеси с контактами появляется возможность переключения между ее состояниями с различными значениями проекции полного спина. 26 февраля 2014г. Сергей Григорьевич Тиходеев (Институт общей физики им. А.М. Прохорова РАН) . ... V.V. Ryazanov, УФН 169, 920 (1999). ...
NMW survey overview . Access image archive . ... The New Milky Way survey aims to detect bright (V<13.5) optical transients near the Galactic plane using an automated wide-field (8x6 deg.) system capable of surveying the whole Milky Way area visible from the observing site in one night. ... All images obtained during the transient search survey are available online (please use the image archive access form ). ... Images per field: . ... Images per night: . ... Milky Way imaging time: . ...
О лаборатории . ... Лаборатория теоретической биофизики . ... In our previous article (<a href=? http://erg.biophys.msu.ru/wordpress/archives/706 ? ... Here we generalize this technique for the љtwo-dimensional space. ... Let us demonstrate how the discrete Laplacian is used in explicit scheme of solving the reaction-diffusion system . ... Нет комментариев " Reaction-diffusion systems in 2D space with python " . ... Reaction-diffusion systems in 2D space with python . ... 2016 ERG Research Group . ...