... In the 1970s, George Ritzer transformed Kuhnian paradigm into a consolidativeimaginary paradigm and suggested multi-paradigmatic model of sociology. ... N.Y., 1972; Levine D. Visions of the sociological theory. ... 4 Kuhn T. The structure of scientific revolutions. ... 6 Ritzer G. Sociology: a multiple paradigm science. ... Cambridge, 1970. ... On theoretical sociology" (N.Y., 1957) "Paradigms: codification of sociological theory" "On social structure and science" (Chicago, 1996), "" "" "". . ...

Еще в разделе: (Показать все результаты (>33) - vestnik.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/archive/2010/3/02.pdf

Sample Submission Form for Example Measurements In order to provide the best and most appropriate measurement/results, the customer is asked to please fill in the following form and enclose it with the sample. This form or equivalent information is required prior to the sample measurements. ... WITec can not provide specialised sample preparation. Measurement Goal: What's the goal of the measurement? ...

Еще в разделе: (Показать все результаты (>24) - nano.msu.ru/ )

• Announcement about the admission to MSU Graduate School for a new Master?s
• Fundamentals of Nanotechnology, 2009 | MSU Nanotechnology Education and
• Contact ERC | MSU Nanotechnology Education and Research Center

... The Informativeness of Coherence Analysis in EEG Studies A. P. Kulaichev UDC 612.821.6 Translated from Zhurnal Vysshei Nervnoi Deyatel'nosti imeni I. P. Pavlova, Vol. ... KEY WORDS: coherence, spectral analysis, EEG non-stationarity, amplitude modulation. ... In particular, the two fundamental differences between EEG signals and most other physical signals are not considered: a) fundamental non-stationarity; b) amplitude modulation at all frequency ranges. ... Coherence in technical addenda. ...

Еще в разделе: (Показать все результаты (>12) - www.protein.bio.msu.ru/ )

Application of the V--Ray Technology for Optimization of the TRFD and FLO52 Perfect Club Benchmarks to CRAY Y--MP and CRAY T3D Supercomputers Alexander S. Antonov, Vladimir V. Voevodin Moscow State University, Russia e­mail: voevodin@vvv.srcc.msu.su Abstract The paper shows an application of the so­called V­ Ray Technology for optimizing the TRFD and FLO52 Perfect Club Benchmarks to CRAY Y--MP and CRAY T3D supercomputers. ... Results for CRAY Y­MP supercomputers. al structure of the program. ...

Еще в разделе: (Показать все результаты (>5) - asa.guru.ru/ )

THE LABORATORY OF CHEMISTRY AND PHYSICS OF SENSOR AND SEMICONDUCTOR MATERIALS . PhD, scientist Galina Ya. Pushkina . ... Synthesis and investigation of physicochemical properties of complex phosphates and vanadates of alkali and alkali-earth metals. ... Synthesis and characterization of solid solution in ABCO 4 system. ... Неорган. материалы, 2005, т.41, ?8, с.1-4. ... 2008-2010 The Laboratory of chemistry and physics of sensor and semiconductor materials. ...

Еще в разделе: (Показать все результаты (>16) - www.lssm.inorg.chem.msu.ru/ )

• Лаборатория химии и физики полупроводниковых и сенсорных материалов | Яшина
• The Laboratory of chemistry and physics of sensor and semiconductor materials

... The 56th ASMS Conference on Mass Spectrometry took place in Denver (CO, USA), June 1-5, 2008. ... International conference "Mass Spectrometry and Allied Topics" is an annual meeting of the American Society for Mass Spectrometry (ASMS). ... ASMS was founded in 1969 and, as of 2008, has approximately 7000 members, working on scientific reseach and development in mass spectrometry methods and instruments. ... The 56th ASMS Conference on Mass Spectrometry lasted five days. ... FT-ICR mass spectrometry ....

Еще в разделе: (Показать все результаты (>4) - ani.cs.msu.su/ )

• The ASR Department at the CMC Faculty of Lomonosov MSU

.. .. .. « » 01 -07 .., . «» 2010 532.516.532.517 35.114 43 43 « » 01 - 07 2010 . . . . «» ­ : . 2010. - 196. . . , . 532.516.532.517 35.114 © . .., 2010 XIX - () « » 1 7 2010 . «» . 60 , 14 . : ( ) , ( , ) . 42 30 . .. .. ­ .. , .. .. « ». . .. , .. , .. ( . ), .. , .. , .. (. ), .. , .. (. ) .. (. --). , 1976. . .. . , 30 «» - 3 , . .. (15 2009) .. (25 2008). , .. .. . - , . . . ..-.. .. 4 « » 1. .. . 2. .. . 3. .. ( , ) . 4. .., .., .., .. «» . 5. .. - . 6. .. . 7. .. - . 8. .. . 9. .., .., .. 5 . . 10.

Еще в разделе: (Показать все результаты (>19) - hit-conf.imec.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom2_2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf

... О кафедре . ... Завершился курс "Методы лабораторных зоологических исследований", впервые проводимый в этом году. ... 11-й Морской семинар! Продолжить чтение . 31 марта 2016 (четверг), 13:00, 594 ауд. - заседание кафедры . ... Десятый семинар центра морских исследований МГУ . ... Девятый семинар центра морских исследований МГУ . ... JavaScript must be enabled in order for you to use Google Maps. However, it seems JavaScript is either disabled or not supported by your browser. ...

Еще в разделе: (Показать все результаты (>3) - invert.bio.msu.ru/ )

• История кафедры
• Учебный процесс

... Abstract A Uniform Resource Identifier (URI) is a compact string of characters for identifying an abstract or physical resource. ... This document defines a grammar that is a superset of all valid URI, such that an implementation can parse the common components of a URI reference without knowing the scheme-specific requirements of every possible identifier type. ... URI-reference = [ absoluteURI | ... Otherwise, the reference URI's scheme is inherited from the base URI's scheme component. ...

Еще в разделе: (Показать все результаты (>4) - hea-www.harvard.edu/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1808.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1945.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc2068.txt

... General Information . ... For physics faculty . ... Until 1939 in Moscow State University there was one undivided General Physics Chair. ... He was a leading scientist in the field of magnetic phenomena, and during 14 years the experimental and theoretical research of condensed matter magnetization, magnetic hysteresis and ferromagnetic resonance have been conducted under his leadership. ... In 2003 the Chair was renamed to Chair of General Physics and Magneto-Ordered Matter. ...

Еще в разделе: (Показать все результаты (>18) - ferro.phys.msu.ru/ )

• Physics Department of Moscow State University
• Laboratory of Ferroelectricity

... Specialist degree . ... Master degree . ... Master variants . ... About Faculty . ... Mechmath faculty admission resumed its work and is actively preparing for the new reception 2015! ... Read more about Schedule in June . ... The Dean of Mechanics and Mathematics Faculty, the head of the Department of Mathematical and Computer Analysis Methods, professor Vladimir Chubarikov ; . ... Read more about The Open Day . ... 2016 Mechmath admission for internetional students ...

Еще в разделе: (Показать все результаты (>8) - pk.math.msu.ru/ )

• IX Festival of Science | Mechmath admission for internetional students

... Institute of Mechanics . ... In 1977- 1991 A .P.Seyranian was a Member of Scientific Staff at the Institute of Problems in Mechanics of the Academy of Sciences in Moscow . ... Since 1993 A .P.Seyranian is a Leading Researcher and Professor of the Institute of Mechanics , Moscow State Lomonosov University . ... In 2003 he became an Invited Speaker and Chairman of the Session 'Stability and Control Problems in Mechanics' at the conference 'Physics and Control 2003' , Sankt-Petersburg. ...

Еще в разделе: (Показать все результаты (>2) - seyranian.imec.msu.ru/ )

... Новое о трансдуцерном рецепторе цитокинов gp130 в онкогематологии: Возможности применения сандостатина у онкологических больных . ... Beglinger C., Drewe J. Somatostatin and octreotide: physiological background and pharmacological application. ... Degen L., Beglinger C. The role of octreotide in the treatment of gastroenteropancreatic endocrine tumours. ... Cascinu S., Fedeli A., Fedeli S., Catalano G. Control of chemotherapy-induced diarrhoea with octreotide in pts receiving 5-fluorouracil. ...

Еще в разделе: (Показать все результаты (>242) - www.nature.web.ru/ )

• Клинико-патогенетическая оценка синдрома головной боли при мозговом инсульте
• Алекситимия
• Современное состояние иммунологической диагностики аутоиммунных заболеваний

... О межфакультетских курсах МГУ . Видео МФК . ... Канал МГУ на YouTube . ... Комментарии Дата Просмотры Лайки Комментарии Упорядочить по возрастанию . ... x25BA; Кинофонд МГУ (95) . ... x25BA; Фильмы о МГУ (5) . ... x25BA; СУНЦ МГУ (5) . ... x25BA; МФК (1084) . ... x25BA; Механико-математический факультет (5) . ... x25BA; Социологический факультет (13) . ... x25BA; Факультет журналистики (11) . ... x25BA; Факультет наук о материалах (7) . ... Copyright 2016 ї Видеоархив МГУ имени М.В.Ломоносова . ...

Еще в разделе: (Показать все результаты (>176) - media.msu.ru/ )

• Университетские субботы (МГУ-школе) | Видеоархив МГУ имени М.В.Ломоносова

Exchanges Exchanges with Moscow University . ... Exchanges . ... Students studying at partner universities may come as exchange students to Moscow University according to conditions set up by exchange agreements. ... Formal nomination letter signed by head of international office of home university. This letter shoull arrive in original and by fax to +7 (495) 9328960 or as scanned copy to e-mail of a proper coordinator . Personal application , also as original and by fax/e-mail. ...

Еще в разделе: (Показать все результаты (>3) - www.ied.msu.ru/ )

Cell. ... 2012) 69:1787­1797 DOI 10.1007/s00018-011-0895-z Cellular and Molecular Life Sciences REVIEW Cytochrome c: the Achilles' heel in apoptosis A. V. Kulikov · E. S. Shilov · I. A. Mufazalov · V. Gogvadze · S. A. Nedospasov · B. Zhivotovsky Received: 5 September 2011 / Revised: 30 October 2011 / Accepted: 22 November 2011 / Published online: 17 December 2011 с Springer Basel AG 2012 Abstract Cytochrome c is a well-known ... How is cytochrome c released from mitochondria? ...

Еще в разделе: (Показать все результаты (>4) - www.fbm.msu.ru/ )

• http://www.fbm.msu.ru/about/struct/labs/lima/paper1.pdf
• http://www.fbm.msu.ru/about/struct/labs/lima/paper7.pdf

... Department of Mathematics, . Faculty of Physics, MSU . ... Mathematical analysis 2 . Numerical Methods (A.N. Bogolyubov) . ... Asymptotic methods in nonlinear problems of mathematical physics . ... Extremal problems . ... Methods of finite differences in mathematical physics . ... 13 th Annual workshop will be organized by the of Department of Mathematics of Physics Faculty at Moscow State University , Moscow, Russia. ... Department of Mathematics, Faculty of Physics, Lomonosov MSU 2014-2016 ...

Еще в разделе: (Показать все результаты (>3) - math.phys.msu.ru/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>16) - tukachev.flogiston.ru/ )

• Category: Новости

... defmacro defprinter ( name args &body body ) . ... body ) ) . ... defprinter :property ( type name &rest body ) . print-statement-with-body stream body nil "public ~a ~a" type name ) ) . ... defprinter :get ( &rest body ) . print-statement-with-body stream body nil "get" ) ) . ... defprinter :constructor ( name args &rest body ) . ... defprinter :class ( name &rest body ) . print-statement-with-body stream body t "public class ~a" name ) ) . ... defprinter :namespace ( name &rest body ) . ...

Еще в разделе: (Показать все результаты (>2) - depni.sinp.msu.ru/ )