THE JOURNAL OF CHEMICAL PHYSICS 136, 034902 ( 2012 ) Electrostatic interaction of neutral semi-permeable membranes Olga I. Vinogradova,1,2 , and Vladimir Lobaskin6 1 a) Lyderic Bocquet,3 Ar tem N. Bogdanov,1 Roumen Tsekov,4,5 A. N. Frumkin Institute ... This gives rise to a distance-dependent membrane potential, which translates into a repulsive electrostatic disjoining pressure. ... Phys. 136, 034902 (2012) interacting semi-permeable membranes. ... The membranes are located at |x| = h/2. ...

Еще в разделе: (Показать все результаты (>36) - nanofluidics.phys.msu.ru/ )

• http://nanofluidics.phys.msu.ru/paper/pre2012_1.pdf
• http://nanofluidics.phys.msu.ru/paper/Mendeleev-2012.pdf
• Teaching

. A. N. Tikhonov

Еще в разделе: (Показать все результаты (>34) - foroff.phys.msu.ru/ )

• Конференции, в которых наша группа принимает участие
• Programs, numerical algorithms
• Links

The 3 rd Autumn forum of volunteers in MGU. Last weekend the chemical faculty of MGU held the Autumn forum of volunteers from Russian organization "World4U". The university students and visitors from abroad discussed actual problems of science and life. ... Lectures after V. Vinogradov to be read at the philological department. ... Students of historical department of the Moscow State University are thinking over the possibility to create a Museum of substitutes for modern money. ...

Еще в разделе: (Показать все результаты (>9) - www.rlcentre.com/ )

• "ABOUT RUSSIAN" - news about Russian language and Russia

О кафедре . ... Динамические задачи теории упругости . Динамика пластин и оболочек . ... Методы теории упругости . ... Нелинейная теория упругости . ... Пластины и оболочки . ... Теория и расчет оболочек тонкостенных летательных аппаратов . ... Теория упругости структурно-неоднородных тел . ... Уравнения изгиба пластин классическая линейная теория. ... Колебания пластин. ... Oscillation of plates . ... МГУ им. М.В.Ломоносова, механико-математический факультет, кафедра теории упругости . ...

Еще в разделе: (Показать все результаты (>2) - elast.math.msu.su/ )

MGU Botanic Garden . SCHEDULE OF EXCURSIONS FOR INDIVIDUAL VISITORS . If you want to express your opinion about our excursions or suggest any proposals and make remarks, write us at otzyv_botsad@mail.ru . ... The excursion bureau of the MSU Botanical Gardens invites in May-October schoolchildren, students and anyone wishing to admire the open air collections and listen to the captivating stories about plants. ... Plant taxonomy (for schoolchildren and university students) . ...

Еще в разделе: (Показать все результаты (>10) - botsad.msu.ru/ )

... Интегрированные среды разработки появились с расширением использования шейдеров в графических приложениях. Они позволяют быстро описывать различные эффекты при помощи комбинаций шейдеров, параметров, текстур, моделей и т.д. и получать готовый результат. ... Обычно такие среды являются многоплатформенными, т.е. поддерживают ГПУ различных производителей и различные графические технологии программирования. ... Интегрированные среды разработки могут быть рекомендованы начинающим программистам ГПУ. ...

Еще в разделе: (Показать все результаты (>2) - gpu.parallel.ru/ )

Evgeny Antipov (Moscow U) Q: What structural type is more preferable for practical applications? It depends on the type of application. For portable applications -NaFeO2 (derived from the rock-salt type) is preferable because this layered structure provides relatively high specific energy and fast Li-ion diffusion in solid-state and, respectively, high specific power. ... However, specific energy is close to that one for LiFePO4 because of the lower capacity (146 mAh g-1). ...

Еще в разделе: (Показать все результаты (>17) - www.elch.chem.msu.ru/ )

• http://www.elch.chem.msu.ru/mole/lecture/nazmutdinov.pdf
• http://www.elch.chem.msu.ru/mole/lecture/probst.pdf
• http://www.elch.chem.msu.ru/mole/lecture/qkosova.pdf

... Physics of ferroelectrics, structural phase transitions, critical phenomena, physics of real crystals. ... Experimental study of the anomalous change of physical properties at ferroelectric phase transitions. ... Discovery of the new type of the change of the phase state of ferroelectric crystals - critical and overcritical behaviour near isostructural phase transition points. ... B.A.Strukov, "Global Hysteresis in Ferroelectrics with Incommensurate Phase", Phase Transitions, 15, 143-179 (1987). ...

Еще в разделе: (Показать все результаты (>20) - ferro.phys.msu.ru/ )

• Department of General Physics and magneto-ordered matter. Physics Faculty of

... TELLING AMERICA'S STORY: NARRATIVE FORM AND THE REAGAN PRESIDENCY WILLIA M E LEWI S By 1980 , Americ a ha d los t its sense of direction . ... The n Ronal d Reaga n cam e ont o th e scene wit h a visio n of America that reinvigorate d th e nation . ... NARRATIV E FOR M I N REAGAN' S RHETORI C Reaga n tells tw o kind s of stories tha t differ in scale an d purpose , but that wor k togethe r to establish th e dominanc e of narrativ e form in th e creation and in th e interpretatio n of his rhetoric . ...

Еще в разделе: (Показать все результаты (>63) - genhis.philol.msu.ru/ )

• Конфенеция 'Современные методы сравнительно-исторических исследований'

. | home | publication | persons | referencesdb | contacts | . BABY MAX LINKS . Links . ==BABY=MAX=SILLy=pAGES== . ==bABY=MAx=mGUmuS=pAGEs== . | home | publication | persons | referencesdb | contacts | .

Еще в разделе: (Показать все результаты (>4) - www.mgumus.chem.msu.ru/ )

... Moscow 119992, Russian Federation Analytical and Bioanalytical Chemistry DOI 10.1007/s00216-004-2968-4 Special Issue Paper Using enzymes isolated from diverse sources to determine metal ion cofactors Tatyana N. Shekhovtsova () · Svetlana V. Muginova T. N. Shekhovtsova · S. V. Muginova Chemistry Department, Lomonosov ... Alkaline phosphatases are known to be metal-dependent enzymes containing two metal ions: zinc and magnesium at their catalytic and allosteric sites, respectively. ...

Еще в разделе: (Показать все результаты (>25) - analyt.chem.msu.ru/ )

• Moscow State University: Analytical Chemistry Division

Thunderstorms and Elementary Particle Acceleration . ... Conference . The first announcement . ... The Thunderstorms and Elementary Particle Acceleration (TEPA-2012) conference is the second one devoted to the studies of the extreme atmospheric effects connected with amplification of electric fields in the lower atmosphere. ... TEPA-2012 conference will be held from July 9 till July 11, 2012, just after the 23rd European Cosmic Ray Symposium also organized by MSU ( http://ecrs2012.sinp.msu.ru ) . ...

Еще в разделе: (Показать все результаты (>2) - tepa2012.sinp.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom_2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/genome_biol_evol_2014.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/mol_biol_mosk_2006.pdf

Materials Science in Semiconductor Processing 4 ( 2001 ) 51-53 Probe of the vicinal Siр111Ю surface by second harmonic phase spectroscopy D. Schuhmachera,*, G. Marowskya, A.A. Fedyaninb, T.V. Dolgovab, O.A. Aktsipetrovb a Laser-Laboratorium Gottingen e ... 1, 37077 Gottingen, Germany Е Е b Department of Physics, Moscow State University, 119899 Moscow, Russia Abstract The intrinsic surface sensitive technique of optical second harmonic (SH) phase and ... 2001 Elsevier Science Ltd. ...

Еще в разделе: (Показать все результаты (>28) - shg.phys.msu.ru/ )

• http://shg.phys.msu.ru/ruscon/articles/pdf/02_PRB_66.pdf
• http://shg.phys.msu.ru/ruscon/articles/pdf/02_JETP_76_527.pdf
• http://shg.phys.msu.ru/ruscon/articles/pdf/04_LasPhys_14_MPC.pdf

... Coordination of economic policies and convergence of economic performance are fundamental to the integration of national economies in the Community. ... When U.S. President Barack Obama enters his White House meeting with Israeli Prime Minister Benjamin Netanyahu on March 5 -- angling to dissuade Israel from attacking Iran's nuclear facilities -- there will be one seemingly mundane issue on his mind that he may be too uncomfortable to share with his guest: gasoline prices. ... 2004. ...

257. http://www.fbm.msu.ru/about/struct/labs/lima/paper1.pdf

258. http://sun.sai.msu.ru/texts/somov-1-10Lect.pdf

259. SPHERE status 1996