... взаимодействие языка и культуры в контексте сравнительно-исторических исследований; . ... The Philology Faculty of Moscow State Lomonosov University will hold the VIII International Scientific Conference on Comparative-Historical Linguistics 'Modern methods of comparative historical research', from 25 to 27 September 2013, which is traditionally organized by the Department of General and Comparative-historical linguistics. ... History of Comparative Linguistics. ...

Еще в разделе: (Показать все результаты (>36) - genhis.philol.msu.ru/ )

. Nhunt: program for nucleic acid sequence similarity search . Download . User manual . Application examples . License . News . About . Authors publications . Contacts . Web interface . At present you can download poster from MCCMB'11 conference and my term work (in Russian) with description of main program algorithms. Funding: Ministry of Education and Science of the Russian Federation (State Contract No. 07.514.11.4006). Copyright 2010-2011 Yury Pekov

Еще в разделе: (Показать все результаты (>3) - mouse.genebee.msu.ru/ )

... Главная Студентам Студенческая жизнь . ... Торжественная церемония вручения дипломов выпускникам факультета политологии . Выпускники факультета политологии получили дипломы с отличием из рук ректора МГУ В. А. Садовничего . ... Состоялась презентация кафедры истории и теории политики для студентов 1 курса факультета политологии . ... Межфакультетские курсы МГУ на факультете политологии . ... Поступление на факультет политологии в 2016 году . ... Информация о переводе на факультет политологии . ...

Еще в разделе: (Показать все результаты (>7) - polit.msu.ru/ )

... Salmonella typhimurium LT2, section... 571 e-164 AE012388 AE008922 |AE012388| ... Salmonella typhimurium LT2, section.. ... Length = 20095 Score = 571 bits (1472), Expect = e-164 Identities = 286/298 (95%), Positives = 292/298 (97%) Frame = -2 Query : 1 MANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSF 60 MANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSF Sbjct : 10035 MANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSF 9856 ...

Еще в разделе: (Показать все результаты (>682) - kodomo.fbb.msu.ru/ )

• http://kodomo.fbb.msu.ru/~smivic/Projects/Term_3/Downloads/gluq_pm_n.blast
• http://kodomo.fbb.msu.ru/~element/Term3/pm.txt
• http://kodomo.fbb.msu.ru/~smivic/Projects/Term_3/Downloads/gluq_pm.blast

... Biological Faculty . Moscow State Lomonosov University . ... EDUCATION : B.S. Lomonosov Moscow State University, 1971 Physics . M.S. Lomonosov Moscow State University, 1972 Biophysics . Ph.D. Lomonosov Moscow State University, 1978 Biophysics . ... Lomonosov Moscow State University, 1990 Biophysics . ... 1972-1978 Research assistant Lomonosov State University, Moscow . ... Mathematical modelling in biology, . ... Lecturer at Biological Faculty, Lomonosov State University, Moscow . ...

Еще в разделе: (Показать все результаты (>2) - biophys.msu.ru/ )

... High Power Linear Accelerators . Fig 3a: One-section schematic . ... Our CW LINAC family consists of ten accelerators each with beam currents of 50 mA and energies ranging from 0.6 to 6 MeV in increments of 600 keV with corresponding beam power of 30 to 300 kW. ... Fig 4a: Two-section schematic . ... Our two-section CW LINAC seen in Fig. 4 consists of one-section CW LINAC, beam line between first and second AS, and second AS which accelerates the 50 mA beam up to the energy 1.2 MeV. ... 0.6 MeV . ...

Еще в разделе: (Показать все результаты (>2) - vserv.sinp.msu.ru/ )

Это новая версия каталога журналов, первоначально созданная Владимиром Мельгуновым. ... Acta Crystallographica Section A ? ... International Union of Cry.. Chemistry . ... Structural Science . ... Wiley Interscience ] . ... Beilstein Journal of Organic Chemistry . ... Chemistry Central Journal . ... International Journal of Mass Spectrometry . Elsevier Science ] . ... International Journal of Mass Spectrometry and Ion Physics . ... International Journal of Molecular Sciences . ... JCatalog | ...

Еще в разделе: (Показать все результаты (>165) - journals.genebee.msu.ru/ )

• JCatalog journal list
• JCatalog >> Journal information >>

OStability of Bars with Variable Rigidity / Gorbachev V.I., Moskalenko O.B. // Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>16) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika

... Полная версия: Burn the floor OST . Грация-МГУ::Форум > Мультимедия > Аудио . ... Aug 10 2009, 07:53 . ... Burn The Floor . 01 - Hinda Hicks - Burn The Floor . ... 04 - London Orchestra - 30's Section . 05 - London Orchestra - Jumpin' Jive And Wail . ... 09 - London Orchestra - Passionata . ... Burn The Floor - Floorplay . ... 13 - Sing Sing Sing (Part2) . ...

Еще в разделе: (Показать все результаты (>272) - grace.msu.ru/ )

• Грация-МГУ::Форум > Технические работы на сервере
• Технические работы на сервере - Грация-МГУ::Форум

... Архив новостей . ... После летнего перерыва возобновил свою работу научный семинар лаборатории термохимии. 16 сентября было проведено заседание, на котором м.н.с. Овчинникова Н.С. и асп. 3-го г/о Самохвалов П.С. сделали доклады об участии в конференциях "International Conference on Coherent and Nonlinear Optics and International Conference on Lasers, Applications, and Technologies (2010)" (Казань, Россия) и " International Workshop "Nanocarbon Photonics and Optoelectronics (2010) " (Коли, Финляндия)...

Еще в разделе: (Показать все результаты (>7) - thermolab.chem.msu.ru/ )

by Margarita Dzhalalova It is known that the pressure difference values for a round parachute are constant over total canopy, then for a square parachute the values of pressure difference are non-uniform along radial ribbons differing even from each other and depending mainly on certain sets of line lengths, and therefore square parachutes attain different shapes from each other ( Fig.1 - photo of var.1 and var.2). ... Distribution of pressure coefficient along radial ribbons of square parachute. ...

Еще в разделе: (Показать все результаты (>4) - margaret.imec.msu.ru/ )

... Institute of Mechanics . ... In 1977- 1991 A .P.Seyranian was a Member of Scientific Staff at the Institute of Problems in Mechanics of the Academy of Sciences in Moscow . ... Since 1993 A .P.Seyranian is a Leading Researcher and Professor of the Institute of Mechanics , Moscow State Lomonosov University . ... In 2003 he became an Invited Speaker and Chairman of the Session 'Stability and Control Problems in Mechanics' at the conference 'Physics and Control 2003' , Sankt-Petersburg. ...

Еще в разделе: (Показать все результаты (>3) - seyranian.imec.msu.ru/ )

• Selected Photos

sparallel.ru . Спортивная женская обувь nike . Детская обувь elegami купить . Posted by admin . Почитатели Michael Kors это люди бизнес-класса, которые ценят каждую секунду своего времени и выбирают лучшее, а сумка Michael Kors ? объект желания всех женщин. Линия Michael Michael Kors продается во многих ведущих магазинах по всему миру. ... К примеру, на сумки Michael Michael Kors цена в пределах 0. ... Ботильоны michael . Обувь jana 25410 . ... Зимняя женская обувь 2013 20 . ...

Еще в разделе: (Показать все результаты (>17) - sparallel.ru/ )

• Michael jordan кроссовки | sparallel.ru
• admin | sparallel.ru - Part 295
• sparallel.ru - Part 295

... E. Huhlaev, Metamake Tools for Personal Project Preparation in Heterogeneous Network Environment (ID=260), Word doc . ... O. Kodolova, Experience with OO Database for CMS Events Distributed Between Two Sites (ID=294), PDF file . ... A. Nikitin, The GA Based Approach to Optimization of Parallel Calculations in Large Physics Problems (ID=220), Word doc . ... J. Seixas, Neural Particle Discrimination for Triggering Interesting Physics Channels Using Calorimetry Data (ID=311), PDF file . ...

Еще в разделе: (Показать все результаты (>48) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/abstracts.html
• http://acat02.sinp.msu.ru/24june.html
• http://acat02.sinp.msu.ru/schedule.html

... References . ... References to books should include the author's name; year of publication; title; page numbers where appropriate; publisher; place of publication, in the order given in the example below. ... Ramirez, F. J., Marquez, R. A. C., and Mondaca, G.: 1991, The 1877 great tsunami and the rapid local warning network in the coast of Northern Chile - South America, In: Proc. International Conference of Australian Earthquake Engineering Society , Brisbane, Australia, 25-1. ... Information . ...

Еще в разделе: (Показать все результаты (>16) - seac47-2.phys.msu.ru/ )

JOURNAL OF STRUCTURAL BIOLOGY 113, 217-224 (1994) Centrosome Behavior under the Action of a Mitochondrial Uncoupler and the Effect of Disruption of Cytoskeleton Elements on the Uncoupler-lnduced ... 119899, Russia Received October 3, 1994, and in revised form February 6, 1995 Carbonyl cyanide p-(trifluoromethoxy)phenylhydrazone ( FCCP ) induced in pig kidney embryo cells a loss of rhodamine 123 staining of mitochondria in 2-3 min ... In 3 cells, the active centriole possessed three satellites. ...

Еще в разделе: (Показать все результаты (>25) - cellmotility.genebee.msu.ru/ )

Lomonosov Moscow State University Biological faculty Botanical garden (Russia) (http://botsad.msu.ru/eng_news.htm) Botanical garden of the Komarov Botanical institute (Russia) Russian Iris Society Botanical garden of Taurida National Vernadsky University (Ukraine) The second information message Dear colleagues! ... Educational and enlightening activities based on collections of genus Iris L. The program of the Symposium will consist of plenary and sectional sessions as well as poster presentations. ...

Еще в разделе: (Показать все результаты (>10) - botsad.msu.ru/ )

The files containing information about Affymetrix microarrays were downloaded from the official Affymetrix site. ... Probe sequences were mapped to the genome using Blat. ... The hits found "probe alignment regions" were . ... We annotated each probe alignment region using the mRNA and EST alignments provided by UCSC, considering only . ... The textual part of the interface consists of probe information section, probe alignment section and transcription state . ... Each gene and each probe alignment . ...

Еще в разделе: (Показать все результаты (>5) - mouse.belozersky.msu.ru/ )

Публикации Кучериненко Я.В. Назад в каталог . ... А.А.Ордин, Я.В.Кучериненко. ... A.A.Ordin, Ya.V.Kucherinenko. ... Percolation approach to grain boundary wetting: theory, computer simulation and experiment. ... 2003 . ... International workshop INTERFACES IN ADVANCED MATERIALS, IAM-03, Chernogolovka, Moscow district, Russia, 26-30 May, 2003 2004 . ... Kucherinenko and B. Baretzky. 3-dimensional Wulff diagrams for S3 grain boundaries in Cu // REVIEWS ON ADVANCED MATERIALS SCIENCE, 6 (2004), pp.23-31. ...

Еще в разделе: (Показать все результаты (>22) - cryst.geol.msu.ru/ )

• http://cryst.geol.msu.ru/literature/2008.php
• http://cryst.geol.msu.ru/literature/2008.php/

... Новости . ... О ВШГА МГУ . ... ВШГА МГУ - это подготовка кадров среднего и высшего звена для органов государственной власти РФ, крупных государственно-частных корпораций и бизнес-структур. ВШГА МГУ - это обучение на основе лучшего опыта зарубежных школ публичной администрации и традиций российского образования. ... Международная конференция "МОДЕРНИЗАЦИЯ И ИННОВАЦИИ КАК СТРАТЕГИЯ УСПЕШНОЙ ИНТЕГРАЦИИ МАЛОГО И СРЕДНЕГО БИЗНЕСА РОССИИ В МИРОВОЕ ЭКОНОМИЧЕСКОЕ ПРОСТРАНСТВО В УСЛОВИЯХ ВТО" . ...

Еще в разделе: (Показать все результаты (>6) - anspa.msu.ru/ )