... 1 Study of molecular interactions in suspensions of nanoparticles (nanodiamonds, carbon dots) using laser spectroscopy methods . Supervisor: Dr. Tatiana A. Dolenko . ... Supervisors: Dr. Tatiana A. Dolenko, Dr. Sergey A. Burikov . 3 Raman and IR spectroscopy of aqueous solutions of amphiphilic compounds . ... Supervisor: Dr. Sergey A. Burikov . ... 2016 Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures . ...

Еще в разделе: (Показать все результаты (>26) - rswater.phys.msu.ru/ )

• Dmitry M. Karpov

... Seismo-tectonics of Tsunami . Numerical and Analytical Models of Local Tsunami Behavior . ... During Field Trips, participants will be acquainted with tsunami manifestation sites on the Pacific coast of Kamchatka and the most interesting geological sections showing key marker tephra layers and a tsunami deposits from prehistorical and historical events (including tsunami 1952 Kamchatka tsunami deposits). ... Helicopter trips are strongly depended on the very changeable Kamchatka weather. ...

Еще в разделе: (Показать все результаты (>18) - seac47-2.phys.msu.ru/ )

• LOCAL TSUNAMI WARNING AND MITIGATION

Nova 1998 2 in M31 this image of the second Nova in M31 in 1998, was made from 38 exposures of 45 seconds integration time. It was made at September 21, 22h 20m UT. Telescope was a CG11 at f/6.3, no filters were used. The long list of processing steps caused the artefacts at the overexposed center of the galaxy and in many of the brighter stars. During the exposures thin clouds covered the sky but the CCD cuts through them, allowing me to obtain this result. ...

Еще в разделе: (Показать все результаты (>36) - www.rochesterastronomy.org/ )

• Supernova 1998cc in NGC 5172
• Supernova 2011ek in NGC 918
• Supernova 1999aa in NGC 2595

RIDGE AND TREE FEATURE DETECTION ON IMAGES A. Levashov 2, D. Yurin3 2, 3 1 Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Leninskie Gory, Moscow 119991, Russia 2 alexeylevashov89@gmail.com , 3yurin@cs.msu.ru In this article a new ridge detector with improved non-maxima suppression procedure in scale-space is proposed. ... The algorithm is tested on synthetic, landscape and medical images. ...

Еще в разделе: (Показать все результаты (>7) - imaging.cs.msu.ru/ )

... Новости . ... Лаборатории . ... Оценка и экспертиза почв . ... создать лабораторию экологического почвоведения в составе кафедры географии почв. ... Наибольший интерес вызвало последнее занятие, интегрированное в Парад почв, организованный совместно с факультетом почвоведения МГУ. ... С глубоким прискорбием сообщаем о скоропостижной кончине заведующего лабораторией биоразнообразия почв Института экологического почвоведения МГУљчлен-корреспондента РАН, профессора Чернова Ивана Юрьевича. ...

Еще в разделе: (Показать все результаты (>3) - soilinst.msu.ru/ )

... 960), Faculty of Philology, 1st Building of Humanities, Lomonosov Moscow State University, Vorob'jovy Gory, Moskva, 119899, Russia . ... Department of Russian Linguistics, . ... Getting of Ph.D. degree for a dissertation "Factors and Regularities of Analyticity Development in Language" (Moscow State University, Department of Structural and Computational Linguistics) . ... A member of Moscow University Academic Council for defending doctoral degrees in Slavic and Russian Linguistics (2001 - till now)...

Еще в разделе: (Показать все результаты (>36) - old.philol.msu.ru/ )

... 2 1 2 (2008) 5­9 available at www.sciencedirect.com journal homepage: www.elsevier.com/locate/ecolmodel The impact of different density stresses on the dynamics of two competitive populations Anatoly T. Teriokhin , Elena V. Budilova Department of Biology, Moscow Lomonosov State University, Moscow 119992, Russia article Article history: info abstract We compare the asymptotic dynamics of two competitive populations described by a ... Second, only the density of youngs can be reduced. ...

Еще в разделе: (Показать все результаты (>31) - ecology.genebee.msu.ru/ )

• Персональные страницы

... High Brightness RTM . ... Fig.1a: 70-MeV pulsed race-track microtron . Many applications require compact, inexpensive and efficient source of electron beam in energy range 10-100 MeV. ... Beam is focused by accelerating structure, which acts as RF quadrupole singlet, quadrupole triplets (12) installed at the even orbits return path and by electromagnet quadrupole singlet (9) installed at common axis. ... Fig.1b: 70-MeV RTM Schematic . ... Energy gain: 4.8 MeV / orbit . Orbits: 14 . ...

Еще в разделе: (Показать все результаты (>3) - vserv.sinp.msu.ru/ )

... Sternberg Astronomical Institute , Moscow University . ... Present edition unites two parts of Catalogue of interacting galaxies by B.A.Vorontsov-Velyaminov: the first part (Part 1) containing 355 systems was published in 1959 [1] and the second one (Part 2) with 497 objects - in 1976 [2].Thus two published parts of Catalogue include 852 interacting systems. ... All new of them (1162 by number) were taken from the comments to the galaxies in Morphological catalogue by Vorontsov-Velyaminov et al.[ ...

Еще в разделе: (Показать все результаты (>17) - www.sai.msu.ru/ )

Dear Colleagues, As you know, JENAM-2007 will take place in Yerevan, Armenia. ... JENAM-2007 will consist of 6 Plenary sessions (invited reviews on hot topics of modern astrophysics, 8 EAS Symposia, and 7 Special Sessions (SPS). ... The opening and closing sessions, EAS symposia and special sessions will be organized in the conference halls and auditoria of the Yerevan State University (YSU). ... The proceedings of the JENAM-2007 will be published in the EAS proceedings series in 2008. ...

Еще в разделе: (Показать все результаты (>79) - sai.msu.ru/ )

• GCVS Research Group: Recent publications
• Конференции сайта АстрО

... The Council on Complex Problems of Cosmic Rays of the Russian Academy of Sciences and the Skobeltsyn Institute of Nuclear Physics (SINP) of Lomonosov Moscow State University are planning to held a workshop "Cosmic Ray Physics Large Scale Experiments at the Second Decade of the 21st Century" on May 16-18 2011 at the Moscow State University. ... The Workshop banquet will be held on Tuesday, May 17 th . ... Workshop тАЬCosmic Ray Physics Large Scale Experiments at the Second Decade of the 21st Century"...

Еще в разделе: (Показать все результаты (>5) - tunka.sinp.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>121) - www.genebee.msu.ru/ )

• No title
• Picornaviruses: discovering big in small
• Импакт фактор научных журналов в 2003 году

... 8 DOI: 10.1093/nar/gkh583 Mapping of the second tetracycline binding site on the ribosomal small subunit of E.coli Maria M. Anokhina1, Andrea Barta2, Knud H. Nierhaus3, Vera A. Spiridonova4 and Alexei M. Kopylov1,4,* Department of Chemistry ... University, 119992 Moscow, Russian Federation Received February 5, 2004; Revised March 22, 2004; Accepted April 14, 2004 1 ABSTRACT Tetracycline blocks stable binding of aminoacyltRNA to the bacterial ...

Еще в разделе: (Показать все результаты (>5) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/MolBio6_00KopylovLO.pdf

Software Protection: How to Crack Programs, and Defend Against Cracking" In the first part of this course we will learn how to "crack" programs, i.e.how hackers break into software to extract secrets, remove license checks, etc. ... Learning about this type of computer security is important because many current systems are vulnerable to cracking attacks. ... The course will have practical homework exercises where you will crack small programs, and use tools to protect against cracking. ...

235. Alexander Valeryevich Pozdneev

236. Links -- Laboratory for Neurophysiology and Neuro-Computer Interfaces (MSU,

237. WomenMSU

238. VaST homepage