... The Council on Complex Problems of Cosmic Rays of the Russian Academy of Sciences and the Skobeltsyn Institute of Nuclear Physics (SINP) of Lomonosov Moscow State University are planning to held a workshop "Cosmic Ray Physics Large Scale Experiments at the Second Decade of the 21st Century" on May 16-18 2011 at the Moscow State University. ... The Workshop banquet will be held on Tuesday, May 17 th . ... Workshop тАЬCosmic Ray Physics Large Scale Experiments at the Second Decade of the 21st Century"...
AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...
... 8 DOI: 10.1093/nar/gkh583 Mapping of the second tetracycline binding site on the ribosomal small subunit of E.coli Maria M. Anokhina1, Andrea Barta2, Knud H. Nierhaus3, Vera A. Spiridonova4 and Alexei M. Kopylov1,4,* Department of Chemistry ... University, 119992 Moscow, Russian Federation Received February 5, 2004; Revised March 22, 2004; Accepted April 14, 2004 1 ABSTRACT Tetracycline blocks stable binding of aminoacyltRNA to the bacterial ...
Software Protection: How to Crack Programs, and Defend Against Cracking" In the first part of this course we will learn how to "crack" programs, i.e.how hackers break into software to extract secrets, remove license checks, etc. ... Learning about this type of computer security is important because many current systems are vulnerable to cracking attacks. ... The course will have practical homework exercises where you will crack small programs, and use tools to protect against cracking. ...
Published on Department of the Automation for Scientific Research CMC MSU ( http://ani.cmc.msu.ru ) . ... Alexander Valeryevich POZDNEEV (November 22, 1983, Novosibirsk, Russia) тАФ teaching assistant (assistant professor). Graduated with honours from the Faculty of Computational Mathematics and Cybernetics (CMC) at Lomonosov Moscow State University (MSU) (2006). Succesfully completed postgraduate study at the Faculty of CMC at Lomonosov MSU (2009). ... A.V. Pozdneev. ...
Laboratory for Neurophysiology and Neuro-Computer Interfaces . M.V.Lomonosov Moscow State University . ... Links . ... Yandex /rus/ . ... Weather in Moscow /rus/ . Human Brain Research Group . at Lomonosov Moscow State University Faculty of Biology (Russia) . ... at Lomonosov Moscow State University Faculty of Biology /rus/ . ... the main neuroscience web site in Russia /rus/ . ... Brain-Computer Interface (BCI) Laboratory at Institute for Infocomm Research (Singapore) >> papers . ...
... Научно-исследовательская работа Совета женщин МГУ. ... М.:Изд-во МГУ, 2000). ... ХХ International Conference 'Mathematics. ... МГУ (2012). ... V International conference Russian association of women's history researchers. ... 4 IUPAP International conference on Women in Physics. ... International conference 'From the women's issue to gender studies'. ... 3 IUPAP International conference on women in physics. ... 2 IUPAP International Conference on Women in Physics. ... Совет женщин МГУ, Москва (2000)...
... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...
You are here: Foswiki > System Web > Macros > VarGMTIME (revision 1) E dit A ttach . Syntax: %GMTIME% OR %GMTIME{"format"}% . GMTIME% uses the default date format defined by the {DefaultDateFormat} setting in configure . expands to 10 Apr 2016 - 01:33 . ... day . day of month . ... Example: %GMTIME{"$day $month, $year - $hour:$min:$sec"}% expands to 10 Apr, 2016 - 01:33:16 When used in a template topic, this macro will be expanded when the template is used to create a new topic. ...
You are here: Foswiki > System Web > Macros > VarGMTIME (19 Sep 2010, ProjectContributor ) E dit A ttach . Syntax: %GMTIME% OR %GMTIME{"format"}% . ... expands to 10 Apr 2016 - 22:08 . Supported special format tokens: . ... day . day of month . ... number of week in year (ISO 8601) . ... Example: %GMTIME{"$day $month, $year - $hour:$min:$sec"}% expands to 10 Apr, 2016 - 22:08:29 When used in a template topic, this macro will be expanded when the template is used to create a new topic. ...
... G. F. Handel: Messiah - Part the Second . Г. Ф. Гендель: Мессия - Часть вторая . Part I . Часть I . ... Part III >> . Часть III >> . PART THE SECOND . ... Chorus Behold the Lamb of God, . ... Хор Вот Агнец Божий, . ... and the Lord hath laid on Him the iniquity of us all. ... и Господь возложил на Него грехи всех нас. ... Psalm 22:7-8) . ... Air (soprano) But Thou didst not leave His soul in hell, . ... Chorus The Lord gave the word: . ... Хор Господь даст слово: . ...
... Institute of Nuclear Physics, . ... I have been directly involved in theoretical and phenomenological analysis -- within the D? collaboration -- devoted to a search for single top quark production in the electroweak processes. ... 1] B. Abbott et al. ... D0 Collaboration], ``Inclusive jet production in p anti-p collisions,'' hep-ex/0011036. ... D0 Collaboration], ``Search for electroweak production of single top quarks in p anti-p collisions,'' hep-ex/0008024. ... Phys.Rev.Lett. ...
... Publications . ... Laboratory of Mathematical Methods of Image Processing . Chair of Mathematical Physics . ... Second order Tikhonov regularization method for image filtering . Publication type . Conference paper . ... Publication date . 2006 . Conference . 16th International Conference Graphicon'2006 . ... Title = {Second order Tikhonov regularization method for image filtering}, . ... BookTitle = {16th International Conference Graphicon'2006}, . Year = {2006}, . ...
Running Apache on a heavily loaded web server, one often encounters problems related to the machine and OS configuration. ... Quick and detailed performance tuning hints for BSD-derived systems. ... Depending on the syntactic form of the TZ environment variable, these systems have several different algorithms to determine the local time zone (presumably compatible with something). ... This form delegates the knowledge of the time zone information to an external compiled zoneinfo file ( la BSD). ...
, « » (. .. ) 15:20 () . 48 , olga.ptitsyna@gmail.com . B.V. Somov, Plasma Astrophysics, Part I: Fundamental and Practice, Second Edition, Springer, New York, 2012 http://dx.doi.org/10.1007/978-1-4614-4283-7 B.V. Somov, Plasma Astrophysics, Part II: Reconnection and Flares, Second Edition, Springer, New York, 2012 http://dx.doi.org/10.1007/978-1-4614-4295-0
... Snecma Moteurs (Groupe Snecma, France) . ... The Colloquium-458, organized by EUROMECH , will take place at Institute of Mechanics of Lomonosov Moscow State University (MSU) . ... The subjects of the Colloquium-458 cover important problems dealing with the verification of constitutive equations, the organization of experiments, the connection between microstructures and mechanical properties and the effective utilization of the modern FEM packages. ... France. ... S.-Petersburg State Techn. ...
Laboratory of Micro- and Nanofluidics . ... Prof. Dr. Olga I. Vinogradova . ... Research . ... Job and Diploma/PhD . ... PhD student, Junior Research Fellow . ... Salim R. Maduar studied chemistry at the M.V.Lomonosov Moscow State University. In 2010-2011 he in addition studied functional nanomaterials, and since 2011 studied bionanotechnology at the MSU Nanotechnology Education and Research Center . ... In 2011 he joined the group of Prof. Olga I. Vinogradova to work on his Diploma thesis. ...
Faculty of Physics of Lomonosov Moscow State University . ... Department of Photonics and Microwave Physics is one of the largest departments of Faculty of Physics of Lomonosov Moscow State University . ... Our department holds annual conference on wave phenomena in nonhomogeneous media, physics and applications of microwaves in May in Moscow suburb. ... Physics of microwaves . ... Department of Photonics and Microwave Physics . Faculty of Physics . Lomonosov Moscow State University . ...
... IPI program works with group of sounding curves (from 1 to 100) in one data file. ... If Type of Array is =+3 or +4, then: 7 line : Name of VES (from 1 to 8 symbols) 8 line : number of distances for this VES . 9 line : dV values (in mV or V) 10 line : I values (in mA or A) Examples of *.dtg file : Example 1 for stabilized current AMN array Bilibino-90, VES from 24.5 to 43.0. 1 2 lines - description of data profile 4 1 0 17 1 -3 S { VES number , KeyIP, ?ax.nAB, ...
MSU . ... Every year since 2004, the MSU Science Park has conducted an educational program and an innovation project competition called Success Formula (www.successformula.ru). ... In collaboration with the Center of Technology Transfer at Moscow State University and the Chair of Innovation Economics, MSU Science park offers a wide range of educational programs like Success Formula as well as infrastructure projects geared to the incubation of new technology companies on the Moscow University site. ...