ФИЗИЧЕСКИЕ ПОДХОДЫ В ИССЛЕДОВАНИЯХ ДНК . ... PHYSICAL MODELS IN DNA SCIENCE . ... This process is useful for both physics and biology. ... As an example, we took the problem of interaction of nonlinear physics and mathematics with DNA science, and we discuss what new ideas, physical models, mathematical equations gave this interaction. ... New dynamical models . ... K/2) S n {[ 2R 2 0 [1- cos( Q n,1 - Q n-1,1 )] + u 2 n,1 + u 2 n-1,1 - 2 u n,1 u n-1,1 cos( Q n,1 - Q n-1,1 ) - . ... z n,2 - z n-1,2 | ...

Еще в разделе: (Показать все результаты (>26) - www.library.biophys.msu.ru/ )

... Individual SELEX products, aptamers, are small molecules (40­100 nt) that have a unique three-dimensional structure, which provides for their specific and high-affinity binding to targets varying from low-molecular-weight ligands to proteins. ... Selection of aptamers binding with a target is the key step in SELEX, as aptamers account for only a small fraction of the initial library (one aptamer per 109 to 1013 molecules) [6]. ... Fourth, modification can increase the aptamer affinity for a target. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.ru/pages/pdf/nar2004.pdf

... Publications . ... Number of publications 0 . ... Publication type . ... Borisov A. V. , Kazakov A. O. , Sataev I. R. The Reversal and Chaotic Attractor in the Nonholonomic Model of Chaplygin?s Top . Regular and Chaotic Dynamics, 2014, vol. 19, no. 6, pp. ... Borisov A. V., Kazakov A. O., Sataev I. R., Regular and Chaotic Attractors in the Nonholonomic Model of Chapygin's ball, Russian Journal of Nonlinear Dynamics, 2014, vol. 10, no. 3, pp. ... Institute of Computer Science Izhevsk, 2005 - 2016 . ...

Еще в разделе: (Показать все результаты (>107) - ics.org.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

... Geography of World Economy . ... Recreational Geography and International Tourism . ... Physical Geography and Landscape Science . ... Field stations . ... Educational council . Science . ... International commission on continental erosion . ... Field training . ... Type of field courses . ... Interuniversity council for erosion and fluvial.. ... International programme in Natural Resource Management and Law offers a unique combination of Natural and Environmental Sciences and Science of Law. ...

Еще в разделе: (Показать все результаты (>110) - eng.geogr.msu.ru/ )

• Department of Land Hydrology
• Department of Meteorology and Climatology
• THE MAKKAVEEV LABORATORY OF SOIL EROSION AND FLUVIAL PROCESSES

... Scientific Laboratories . Science . ... Home Science and education Scientific Laboratories Laboratory of Nonlinear Spectroscopy of Ultrafast Processes in Condensed Matter . ... Nonlinear spectroscopy of condenced matter - semiconductors, HTSC, metals, quantum-size structures, etc. ... 1995-2001: task 7.15 of the State Scientific-Technical Program "Physics of Quantum and Wave Phenomena", direction "Fundamental Spectroscopy", the Ministry of Science, Russian Federation . ...

Еще в разделе: (Показать все результаты (>96) - ilc.phys.msu.ru/ )

• Conference on Photo-Excited Processes and Applications
• Laboratory of ultrafast processes in biology

Phase transitions of lipids in membranes Method of DSC In biological membranes the lipid layer, according to all available data, represents a liquid body with viscosity close to viscosity of sunflower oil. ... Not stopping on description of the device, we shall note only, that in the final account the curve of a heat capacity is being measured, i.e. the dependence of a heat capacity of lipids or membranes in a suspension from the temperature. ... Phase transitions of lipids in membranes. ...

Еще в разделе: (Показать все результаты (>26) - foroff.phys.msu.ru/ )

• Postdoctoral training (General Physics and Wave Processes)
• Postdoctoral training of foreign scientists at Physical Department

... 2000. ... С. 3995-4010. ... Комплексная кратковременная модель пром. источников использовалась для оценки выбросов диоксинов и фуранов в районе установки по сжиганию твердых муниципальных отходов в Коламбусе (США) в 1994-1996 г.г. Исходные данные были получены при мониторинге состояния воздуха и почвы и использовании метеоданных, параметров системы выбросов и характеристики пород. ... воздушная среда, диоксины, почва, прогнозирование, фураны . ...

Еще в разделе: (Показать все результаты (>20) - ecoinformatica.srcc.msu.ru/ )

... TUS Ultra high energy cosmic ray detector on-board the Lomonosov satellite . ... We present the simulation framework CRPropa version 3 designed for efficient development of astrophysical predictions for ultra-high energy particles. Users can assemble modules of the most relevant propagation effects in galactic and extragalactic space, include their own physics modules with new features, and receive on output primary and secondary cosmic messengers including nuclei, neutrinos and photons. ...

Еще в разделе: (Показать все результаты (>4) - uhecr.sinp.msu.ru/ )

• UHECR news
• Новости КЛПВЭ

... The Semantic Dictionary RUSLAN-1, the last version being Russian-to-English direction, is a tool for semantic and informational analysis of any coherent Russian text. The rich semantic information contained in the dictionary makes possible local, within one phrase, semantic interpretation as well as semantic analysis of coherent texts. ... Text understanding is very closely related to information analysis (Leontyeva 2000). ... We therefore call it "relative understanding". ...

Еще в разделе: (Показать все результаты (>4) - leontyeva.srcc.msu.ru/ )

• Semantic Resources for Textual Content Compression

Application of the V--Ray Technology for Optimization of the TRFD and FLO52 Perfect Club Benchmarks to CRAY Y--MP and CRAY T3D Supercomputers Alexander S. Antonov, Vladimir V. Voevodin Moscow State University, Russia e­mail: voevodin@vvv.srcc.msu.su Abstract The paper shows an application of the so­called V­ Ray Technology for optimizing the TRFD and FLO52 Perfect Club Benchmarks to CRAY Y--MP and CRAY T3D supercomputers. ... Results for CRAY Y­MP supercomputers. al structure of the program. ...

Еще в разделе: (Показать все результаты (>7) - asa.guru.ru/ )

... The Informativeness of Coherence Analysis in EEG Studies A. P. Kulaichev UDC 612.821.6 Translated from Zhurnal Vysshei Nervnoi Deyatel'nosti imeni I. P. Pavlova, Vol. ... KEY WORDS: coherence, spectral analysis, EEG non-stationarity, amplitude modulation. ... In particular, the two fundamental differences between EEG signals and most other physical signals are not considered: a) fundamental non-stationarity; b) amplitude modulation at all frequency ranges. ... Coherence in technical addenda. ...

Еще в разделе: (Показать все результаты (>12) - www.protein.bio.msu.ru/ )

... Finance for Start-Up . ... Инновационная . структура МГУ . ... Обучение инновационному менеджменту . ... деятельности . ... Process of Forming a Company . ... Typical business development & equity scenario . ... Unfortunately, there is no single type of financing appropriate for all start-up companies and no single path to accessing money. ... 2005 Управление инновационной политики . и организации инновационной деятельности . МГУ им. М.В. Ломоносова . ...

Еще в разделе: (Показать все результаты (>34) - innovation.msu.ru/ )

• Process of Forming a Company - Discussion Question

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... When detection of the change-points in alpha band power was performed as in the previous subsection, more than one change-point per second was obtained in average. ... The hypothesis of the hierarchy of EEG segmental descriptions (Kaplan 1998) (see subsection 7.3.2) is a theoretical reason for introducing the adjustment of the change-point detection probability. ...

Еще в разделе: (Показать все результаты (>63) - brain.bio.msu.ru/ )

• Change-points in multi-channel EEG
• Alexander Kaplan * Александр Каплан
• 7-я Междисциплинарная региональная конференция по биологической психиатрии.

... Group of laser spectroscopy of solutions of supramolecular compounds and nanostructures . Tatiana A. Dolenko . ... Modern methods and possibilities of laser Raman spectroscopy. ... Vibrational spectroscopy of water solutions of amphiphilic compounds. ... Group of laser spectroscopy of solutions of supramolecular compounds and nanostructures is very young. ... Comparison of Input Data Compression Methods in Neural Network Solution of Inverse Problem in Laser Raman Spectroscopy of Natural Waters. ...

Еще в разделе: (Показать все результаты (>30) - rswater.phys.msu.ru/ )

• Laboratory of laser spectroscopy of solutions of supramolecular compounds and

... Master Education . ... Master programs . ... graduates for activities requiring in-depth fundamental and professional knowledge, including research in applied mathematics and computer technology, development and use of mathematical models for processes and objects, development and application of advanced mathematical methods and software to address problems in science, technology, economics and management.The Mathematical and Computational Methods of Image Processing ... master thesis...

Еще в разделе: (Показать все результаты (>18) - hcs.cmc.msu.ru/ )

• The core courses for the specialty "Information Technologies" | Магистерское и
• Master program "Enterprise Information Systems" | Магистерское и послевузовское
• The core courses for the specialty "Applied Mathematics and Computer Science".

... Faculties . ... MSU, Faculty of Global Processes, Russia, 119992, Moscow, GSP-1, 1-51 Leninskiye Gory . ... Our courses are delivered by the leading professors from MSU, the Russian Academy of International Trade, the Moscow State Institute of Foreign Affairs, the Russian Diplomatic Academy, the Russian Academy of Sciences; we also invite specialists from governmental bodies, Russian and international business companies, consular services of the Ministry of Foreign Affairs, and from abroad. ...

Еще в разделе: (Показать все результаты (>71) - www.msu.ru/ )

• MSU Adresses
• The scheme of an arrangement of MSU buildings on Leninskiye Gory

In memory of Sasha Kuznetsov . Only two days ago I came back from a visit abroad to the sorrowful news that our long-time good colleague and friend, a sparkling and noble personality, Alexander Mikhailovitch Kuznetsov, to me and many others, Sasha, had passed away. ... This applied both to his own realm of molecular charge transfer phenomena but also in his interests in broader areas of condensed matter chemical physics. ... Sasha enjoyed high and increasing international respect. ... Back ...

Еще в разделе: (Показать все результаты (>75) - electr003.chem.msu.ru/ )

• Boris B. Damaskin
• Vladimir Sergeevich Bagotsky: List of Publications
• Alexander M. Kuznetsov: List of Publications

... Font: Times New Roman . ... size - А4 (21 cm х 29,7 cm) . ... Title should be typed in capital letters, Times New Roman, size 13, boldface font; formatting: center. ... The title and the number of the table should be center-formatted (Times New Roman, size 11, single-spaced, no period/full stop at the end of the title). ... The title under the illustration should be center-formatted (Times New Roman, size 11, single-spaced, no period/full stop at the end of the title). ... Use Times New Roman size...

Еще в разделе: (Показать все результаты (>32) - www.spa.msu.ru/ )

... The national strategic management system in Russian power industry is far from perfect and is in the process of its formation after a long period of radical reform in the industry. ... This article s goal is to offer a more adaptable conceptual model for national strategic management in a branch of economy (on the example of the electric power industry). ... National strategic management, power industry, conceptual model, level of environmental uncertainty. ... Public Administrarion". ...

Еще в разделе: (Показать все результаты (>180) - ee-journal.spa.msu.ru/ )